KEGG   Methanocorpusculum labreanum: Mlab_1384Help
Entry
Mlab_1384         CDS       T00472                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
mla  Methanocorpusculum labreanum
Pathway
mla00340  Histidine metabolism
mla01100  Metabolic pathways
mla01110  Biosynthesis of secondary metabolites
mla01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Mlab_1384
Enzymes [BR:mla01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     Mlab_1384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH
Motif
Other DBs
NCBI-ProteinID: ABN07550
UniProt: A2ST94
LinkDB All DBs
Position
complement(1410788..1411102)
Genome map
AA seq 104 aa AA seqDB search
MTDAKVFDELWQVICERAASESLEKSYVRHLLFHEKGIDKSLEKVGEEAVEFILAAKNGV
SEKTVGEAADLIFHMMVALKAADVDFDLVEEELAVRRAGMHLHD
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgcaaaagtattcgatgagttatggcaggtcatctgcgaaagggcggcgtct
gaaagtttagagaagtcatatgtgcggcatctcctgtttcatgaaaagggcatcgacaaa
tcccttgaaaaggtaggagaagaggccgttgaattcattctcgccgcaaagaacggcgtt
tctgaaaaaacggtgggagaagcagcggatctcattttccatatgatggttgctttaaaa
gcggctgatgtggactttgatctcgtggaagaagagctcgccgttcgtcgcgccgggatg
catcttcacgattaa

DBGET integrated database retrieval system