KEGG   Methanocorpusculum labreanum: Mlab_1501Help
Entry
Mlab_1501         CDS       T00472                                 

Definition
(GenBank) glutaredoxin
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mla  Methanocorpusculum labreanum
Brite
KEGG Orthology (KO) [BR:mla00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mlab_1501
Enzymes [BR:mla01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Mlab_1501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Glutaredoxin Pyr_redox DAO GIDA FAD_binding_2 Thi4 Thioredoxin_3 NAD_binding_8 FMO-like Thioredoxin_2 GST_N_3 YDG FAD_oxidored FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABN07665
UniProt: A2STK9
LinkDB All DBs
Position
complement(1534467..1535663)
Genome map
AA seq 398 aa AA seqDB search
MLHEVVVYSLSGCPHCKALKTFLDNQNITYTNIDVGEDEKAAAEMIKISGQRGVPVTVID
GEKIVIGDDLKKVMEYLDAPVAVKKTPDVSADHDLVVIGAGAGGLSAAMYGARKGIDMVV
ITGAIGGMVNQSYVVENYPGIPDISGADLMKKIYDHTVNSGGIFVEDVVTGISKAGDVFS
IDTLNGAHYTAKAVIAATGRSPRLSGAKGETDYLGKGVAICTTCDGPLYKNKVVGILGGG
NTAVDMAIELSDIASKIHLIVRSKLKADKVLIDRLKTKKNIVLHKGYTIEEFGGGQFLEY
VILKKQGGITSLLGKGEEKIPVDGVFLGIGLDPNTSIFEGLGVTMNPNKEIIVDIDCNTN
VPGFYAAGDATSIKAKQIASSVGEGVKALLSAYDYLKR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgttacatgaagtggttgtgtactcgctttcaggttgtcctcactgtaaagcattgaaa
acattccttgataaccagaatataacgtacaccaatatcgatgtaggcgaagatgaaaaa
gccgctgctgaaatgataaagatctccggccagaggggggttccggtcacggtcatcgac
ggcgaaaaaatcgttattggcgatgatttgaaaaaagtcatggagtatcttgacgctccg
gttgcggtaaaaaagactccggatgtttctgcagatcatgatctcgtagtgatcggtgcc
ggagccggcggtctgtctgcagccatgtacggcgcccgaaaaggcatcgatatggtcgtg
atcaccggtgctattggaggaatggtgaatcagagttatgttgttgaaaactatcccggc
atccctgatatatccggtgctgatctgatgaaaaaaatctatgatcatacggtaaattca
ggtgggattttcgttgaggatgttgtgaccggcatttccaaagccggggatgttttttcc
attgacacgcttaacggagcccattatactgcaaaagccgtcatagcggccactggaagg
tctccacgtctctccggagcgaaaggcgaaacagactatctcggaaaaggcgttgcgatc
tgtacgacctgtgacgggccgttgtacaaaaataaagtggtcgggatccttggggggggt
aacacggcagttgatatggcgatcgaactgagcgatattgcatcaaaaatccatctgatc
gtccgcagtaagctgaaagccgacaaggttctgatcgaccggctcaaaacgaagaagaac
attgttctgcacaaaggatatactatcgaagaatttggcggcggtcagtttctggaatat
gtgattttgaaaaaacagggcgggatcaccagcctccttggaaaaggtgaagaaaagatc
cctgtcgacggcgtcttccttgggatcggtcttgatccaaacacctccatctttgagggt
cttggagtaacaatgaatccaaataaagagatcatcgtcgatatcgactgcaatacgaat
gttcccggattctatgcggccggagatgcgacctccatcaaagccaagcagatcgcatca
tccgttggtgaaggagtaaaggctcttctttcagcatatgattacctgaaaaggtaa

DBGET integrated database retrieval system