KEGG   Mycobacterium leprae TN: ML0299Help
Entry
ML0299            CDS       T00047                                 

Definition
(RefSeq) oxidoreductase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
mle  Mycobacterium leprae TN
Pathway
mle00730  Thiamine metabolism
mle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mle00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ML0299
Enzymes [BR:mle01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     ML0299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 3HCDH_N AlaDh_PNT_C F420_oxidored NAD_binding_2 Pyr_redox 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 908853
NCBI-ProteinID: NP_301335
Pasteur: ML0299
UniProt: Q7AQJ9
LinkDB All DBs
Position
complement(381655..382677)
Genome map
AA seq 340 aa AA seqDB search
MPSGPPAGSLAVIGGGVIGLSVARRAVQAGWSVRVHRTHEQGASWVAGGMLAPHSEGRPG
EEQLLQLGLRSLRLWHEGGFTDRLAPEVITARESLVVAVDQADVADLRTVADWLSTQGHP
VIWESAARDIEPLLAQGIRHGFWAPNELAVDNRALLAGLCLDCERLGVRWASPVNDLSCV
NADAVVIANGIGAPALWPGLPVRPVKGEVLRLRWRNGCMSLLKRLIRAHVHGRQVYLVPR
ADGVVVGATQYEHGYDTAPVVSGVRDLLDDACAVLPTLGEYELAECAAGLRPTTPNNLPL
VHRLDNRTLVAAGHGRSGFLLAPWTAEQIMFELAAVGAQA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcaggcccacccgcggggtcgctggccgttatcggcggcggcgtcatcgggcta
tcggtggcacgccgcgcagtgcaggccgggtggtccgtgcgtgtacaccggacccacgag
caaggtgcgtcctgggttgccgggggcatgctggccccgcacagcgaaggccggcccggt
gaggaacagttgttgcagctgggcctgaggtcgctacggctgtggcacgaaggtggattt
accgacaggctggctccggaggttattaccgcgcgtgagtcgctggtggtggccgtcgac
caggctgatgtcgctgacctacgcacggttgcggactggttgtccacgcaaggccacccg
gtgatctgggaatctgctgcccgcgacatagaacccctactggcacaaggcatccgacat
ggtttctgggcgcctaacgaactagcagtggacaaccgggccttgctcgccgggctgtgc
ttggactgtgagcgtctaggggtgcgatgggcctcgccggtcaacgatctgtcctgtgtc
aacgcagacgcggtagtgattgccaatggcattggcgctcctgcgctgtggcccggcctg
ccggtccgtccggtcaagggggaagtgctgcgtttgcgctggcgaaatggttgtatgtca
ttgctaaagaggttaattcgagcccatgtgcacggcaggcaggtgtacctggttccgcgt
gcggacggagtagtcgtcggtgccacccagtacgaacacggttacgataccgccccggtc
gtgtcgggcgtgcgtgatctgcttgacgatgcgtgtgccgtgctgccaacgttgggcgag
tacgagctggctgagtgcgcggctggactgcgcccaacgacaccgaataacctgccactt
gtgcaccgcctagataaccgtacgctggtagctgccggccatggcagatcgggatttctg
ttggcaccatggacagctgagcagatcatgttcgaacttgccgcggtcggagcccaagcg
tga

DBGET integrated database retrieval system