KEGG   Mycobacterium leprae TN: ML1678Help
Entry
ML1678            CDS       T00047                                 

Gene name
ddl
Definition
(RefSeq) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mle  Mycobacterium leprae TN
Pathway
mle00473  D-Alanine metabolism
mle00550  Peptidoglycan biosynthesis
mle01100  Metabolic pathways
mle01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mle00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ML1678 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ML1678 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    ML1678 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mle01011]
    ML1678 (ddl)
Enzymes [BR:mle01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ML1678 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:mle01011]
 Precursor biosynthesis
  Amino acid ligase
   ML1678 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 RimK ATPgrasp_ST ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-GeneID: 910044
NCBI-ProteinID: NP_302152
Pasteur: ML1678
UniProt: Q9CBS0
LinkDB All DBs
Position
complement(2021819..2022973)
Genome map
AA seq 384 aa AA seqDB search
MNVYQRPLMPWLPSGGRVRVAVVFGGRSNEHAVSCLSAGSILRNLDRQRFDVVAVGITPE
GTWMLTDPNPDALAIANRQLPAVSCESGIELTLPADPRRSGQLVSLSHGAGLGAGEVLTS
VDVVFPVLHGPYGEDGTIQGLLELARVPYVGAGVLASAAGMDKEFTKKLFAAEGLPLSAY
TVLRPLRPTLHRQECERLSLPVFVKPARGGSSIGISRVSSWGQLPSAIAYARRHDPKVIV
EAAVNGRELECGVLEMPDGTVAASAVGEIRVAGVSGSEDSFYDFTTKYLDDAAELDVPAK
VDDDVADEVRQLAIQAFRAIDCQGLARVDFFLTDDGPVINEINTMPGFTMTSMYPKLWAV
SSVDYPTLLATMVDTALARGVGMR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtctaccagcggcccttgatgccttggctgccatccggcggccgtgtgcgcgtt
gccgtcgtattcggcgggcgcagtaacgaacacgccgtctcctgtctgtctgccggcagc
atcttgcgcaatctggatcgacagcggtttgacgtggtcgcggttggtatcactccggaa
gggacgtggatgctcaccgatcccaacccggatgcgctggcgattgccaatagacagctt
cccgctgtgagctgcgaatcgggaatcgagttgacgctgccggccgatccacggcgcagc
ggtcaactggtgtcactttcacacggcgccggccttggggccggagaggtcctgacgtcg
gtcgatgtggtattcccggtgttacatggtccatatggcgaggacggcaccatccagggg
ctgctggaactcgctcgtgtgccctacgtcggagctggtgttctggccagcgccgccggc
atggacaaggaattcactaagaagctcttcgctgcggagggactgccgttgagcgcgtac
acggtgttgcgtccgttgcggccaacgctgcatcggcaggagtgtgagcggttgagttta
ccggtattcgttaaacccgcacgcggtggctcgtctatcggtatcagccgggtgtcgagc
tggggtcaactgccctccgcgattgcctacgctcgccggcacgatccgaaggtgattgtc
gaggcggcggttaacggccgcgaactggagtgcggcgtgctcgaaatgccggatggcact
gtggcagccagcgcggtgggggaaattcgggtagccggggtgagcggaagcgaggattcg
ttctacgacttcaccaccaaatatctcgacgacgcagccgagttagatgtgcccgccaag
gtggacgatgacgttgctgacgaggtgcgccagctcgcgattcaggcgtttcgggctatc
gactgccagggcctggcacgagttgactttttcctaaccgacgacgggccggtgatcaat
gagatcaacacgatgccggggttcaccatgacctcgatgtacccaaagctgtgggcggtc
agtagcgtggactacccgacgttgctagcgaccatggtggatacggcattggctcggggt
gtgggtatgcgttag

DBGET integrated database retrieval system