KEGG   Mycobacterium leprae TN: ML2118Help
Entry
ML2118            CDS       T00047                                 

Gene name
echA6
Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mle  Mycobacterium leprae TN
Pathway
mle00071  Fatty acid degradation
mle00280  Valine, leucine and isoleucine degradation
mle00281  Geraniol degradation
mle00310  Lysine degradation
mle00360  Phenylalanine metabolism
mle00362  Benzoate degradation
mle00380  Tryptophan metabolism
mle00410  beta-Alanine metabolism
mle00627  Aminobenzoate degradation
mle00640  Propanoate metabolism
mle00650  Butanoate metabolism
mle00903  Limonene and pinene degradation
mle00930  Caprolactam degradation
mle01100  Metabolic pathways
mle01110  Biosynthesis of secondary metabolites
mle01120  Microbial metabolism in diverse environments
mle01130  Biosynthesis of antibiotics
mle01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ML2118 (echA6)
   00650 Butanoate metabolism
    ML2118 (echA6)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ML2118 (echA6)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ML2118 (echA6)
   00310 Lysine degradation
    ML2118 (echA6)
   00360 Phenylalanine metabolism
    ML2118 (echA6)
   00380 Tryptophan metabolism
    ML2118 (echA6)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ML2118 (echA6)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ML2118 (echA6)
   00281 Geraniol degradation
    ML2118 (echA6)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ML2118 (echA6)
   00627 Aminobenzoate degradation
    ML2118 (echA6)
   00930 Caprolactam degradation
    ML2118 (echA6)
Enzymes [BR:mle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ML2118 (echA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 908912
NCBI-ProteinID: NP_302400
Pasteur: ML2118
UniProt: Q50130
LinkDB All DBs
Position
complement(2518770..2519513)
Genome map
AA seq 247 aa AA seqDB search
MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRVIVLTGQGTVF
CAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGPAIGAGLQLAMQCDLRVVAPD
AYFQFPTSKYGLALDNWSIRRLSSLVGHGRARAMLLTAEKLTADIALQTGMANRIGALAD
AQAWAAEVTGLAPLAIQHAKRVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKR
PPKFQGA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgataggtattactcaggccgaaggcgttatgactatcgagctgcagcgtcccgagcgc
cgcaatgccctgaattcgcaacttatcgagaagctgcgggaggctgtgcagaaagctagt
agcgccgacagtgaggtgtctacccgtgtgattgtgttgactggccagggcacggtgttc
tgtgccggcgcggatctgagcggagatgcgtttgccgctgactaccctgaccggctgatc
gagttacacagggtcatggatgctgttccgatgccggtaattggcgctattaacgggccc
gccatcggtgctggtctacagttggccatgcaatgtgatctgcgggttgttgcaccggat
gcgtattttcagtttcctacctcgaaatatggtttggcccttgacaactggagtattcgc
cgactgtcttcgttggttggtcacggccgggcccgcgcgatgctgctgacggcggagaag
ttgaccgccgacatcgcgctgcagaccgggatggccaatcgcatcggtgcactggccgac
gcccaggcctgggccgccgaggtcaccggcctagcaccactggcgatccagcacgccaag
cgggtactcaacgacgacggctctatcgaagaggcgtggccggagcacaagaagctcttt
gacaaggcctggaccagccaggatgtcatcgaagcgcaggtcgcccgggtggagaaacgg
ccacctaagtttcagggggcatga

DBGET integrated database retrieval system