KEGG   Mycobacterium leprae TN: ML2502Help
Entry
ML2502            CDS       T00047                                 

Definition
(RefSeq) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mle  Mycobacterium leprae TN
Pathway
mle00220  Arginine biosynthesis
mle00250  Alanine, aspartate and glutamate metabolism
mle00290  Valine, leucine and isoleucine biosynthesis
mle01100  Metabolic pathways
mle01110  Biosynthesis of secondary metabolites
mle01130  Biosynthesis of antibiotics
mle01210  2-Oxocarboxylic acid metabolism
mle01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mle00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ML2502
   00290 Valine, leucine and isoleucine biosynthesis
    ML2502
   00220 Arginine biosynthesis
    ML2502
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mle01007]
    ML2502
Enzymes [BR:mle01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ML2502
    2.6.1.66  valine---pyruvate transaminase
     ML2502
Amino acid related enzymes [BR:mle01007]
 Aminotransferase (transaminase)
  Class I
   ML2502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 908455
NCBI-ProteinID: NP_302617
Pasteur: ML2502
UniProt: Q9CB19
LinkDB All DBs
Position
2982832..2984145
Genome map
AA seq 437 aa AA seqDB search
MTLYQQISVDGSGTMSDVTTHQLPMHTPGYHRQRAFAQSSKLQDVLYEIRGPVSQHATRL
ETEGHRILKLNIGNPALFGFDAPDVIMRDMIQALPYAQGYSDSQGILPARRAVVTRYELV
DGFPRFDVDDVYLGNGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSLAGGTPVHYL
CDETQGWQPDIADVESKITERTKALVVINPNNPTGAVYSNEILNQIVDLARKHQLLLLAD
EIYDKILYDDTKHISVASIAPDLLCLTFNGLSKAYRVAGYRSGWLAITGPKDHASSFIGG
INLLANMRLCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDVAWTKLNEIPGVSCVK
PTGALYAFPRLDPEVYGIVDDEQLVLDLLLQEKILVTQGSGFNWPAPDHLRLVTLPWSRD
LAAAIDRLGNFLVSYRQ
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
ttgacactatatcagcaaatttcagtggacggcagtggcaccatgagtgacgtgactact
caccagctgcccatgcacacccctggctatcaccggcaacgtgccttcgcgcagtcgtcc
aagcttcaggacgtcctctacgaaatccgtggcccggtgagccagcatgccacacgacta
gaaactgaaggacaccgcatcctcaaactgaatatcggtaacccagcgctgttcgggttc
gacgcacctgacgtaattatgcgcgacatgatccaggcgctgccgtacgcgcaggggtac
tccgactcccagggcatcctgcctgcacgtcgcgcggtggttacccgctacgagctggtc
gacgggttcccccgattcgacgtcgatgacgtctatctcggcaacggcgtctccgagctg
atcacgatgacgctgcaggccctgttagacaacggcgatcaggtgctgatcccctcgccg
gactacccgctgtggacagcgtcgacctcgctggccggtggcacacccgtacattacctc
tgcgacgaaacccaaggctggcaaccagatatcgccgacgtggaatctaagatcaccgag
cgcaccaaagcactggtcgtgatcaaccccaacaaccctaccggcgccgtctacagcaac
gaaatccttaaccaaatagtcgacctagcacgtaagcatcagctgctgctgcttgccgac
gagatctacgacaagattctctatgacgacaccaagcacatcagcgtggcctcaattgcg
cctgatctactgtgcttgaccttcaacggtctttcgaaagcctaccgtgtcgccgggtac
cggtccggctggctagcgatcaccgggcccaaggaccatgccagtagcttcattgggggg
atcaatctactggccaatatgcggttatgcccgaatgttcctgcgcagcatgcgatccag
gtagccctcggtggccaccagagcatcgaagacttggtgctaccgggcggtcggctgctc
gagcagcgtgacgtcgcctggaccaaactgaacgagatcccgggggtgtcatgcgtcaaa
cccaccggtgcactgtatgcctttccccggctagatccagaagtctatggcatcgtcgat
gacgagcaactggtcctcgacctgctactacaagagaagatcctggtcacccagggcagc
ggattcaattggccggcaccggatcatctgcgcttggtgacgctgccgtggtctcgtgac
cttgcggctgcgatcgaccggctcggtaacttcttggtcagttaccgtcaatag

DBGET integrated database retrieval system