KEGG   Methylovirgula ligni: CWB41_02590Help
Entry
CWB41_02590       CDS       T05824                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mlg  Methylovirgula ligni
Pathway
mlg00020  Citrate cycle (TCA cycle)
mlg00190  Oxidative phosphorylation
mlg00650  Butanoate metabolism
mlg01100  Metabolic pathways
mlg01110  Biosynthesis of secondary metabolites
mlg01120  Microbial metabolism in diverse environments
mlg01130  Biosynthesis of antibiotics
mlg01200  Carbon metabolism
Module
mlg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mlg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mlg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mlg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CWB41_02590
   00650 Butanoate metabolism
    CWB41_02590
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CWB41_02590
Enzymes [BR:mlg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CWB41_02590
    1.3.5.4  fumarate reductase (quinol)
     CWB41_02590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer2 Fer4_7
Motif
Other DBs
NCBI-ProteinID: QAY94764
LinkDB All DBs
Position
complement(553251..554030)
Genome map
AA seq 259 aa AA seqDB search
MVQLTLPKNSTISKGKTWPKPEGAVNLREFHIYRWNPDDNLNPRVDTYFVNVDDCGPMVL
DAIIWIKNKVDPTLTFRRSCREGVCGSCAMNIDGTNTLACTRSMTEVKGAIAIYPLPHMS
VVKDLVPDLTNFYAQHASVQPWLQTITPAPEKEWRQTPSDRAKLDGLYECILCACCSTSC
PSYWWNSDRYLGPAVLLQAYRWISDSRDEATGERLDNVEDPFRLYRCHTIMNCAKACPKG
LNPAKAIADIKDLMIERQL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttcagcttacccttcccaagaactcgacaatcagcaagggcaagacctggccgaag
cccgagggcgcggtcaatctgcgcgagttccacatctatcgctggaacccggacgacaat
ctcaatccgcgagtggacacctatttcgtcaatgttgacgattgcggaccgatggttctc
gacgcgatcatctggatcaagaacaaggtcgatccgacgctgaccttccgccgctcctgc
cgcgagggcgtttgcggctcctgcgcgatgaacatcgacggcaccaacacgctcgcctgc
accaggtcgatgaccgaggtgaagggcgccatcgcgatctatccgttgccgcatatgagc
gtcgtcaaggacctcgtgccggacctcaccaatttctatgcgcagcatgcttcggtgcag
ccctggctgcagacgatcacgccggcgccggagaaggaatggcgccagacgccgtccgac
cgcgccaagctcgatggcctctatgagtgcatcctgtgcgcctgctgctcgacctcatgc
ccaagctattggtggaacagcgaccgttatctcggtccggcggttttgcttcaggcctat
cgctggatcagcgattcgcgcgacgaggcgacgggtgagcggctcgacaatgtcgaagat
ccgttccggctctatcgctgccatacgatcatgaattgcgccaaggcgtgcccgaagggc
ctcaatcccgccaaggccatcgccgacatcaaggatctgatgatcgagcggcagctttaa

DBGET integrated database retrieval system