Methylovirgula ligni: CWB41_07245 Help Entry CWB41_07245       CDS       T05824                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mlg  Methylovirgula ligni Pathway mlg01100   Metabolic pathways mlg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mlg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CWB41_07245   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CWB41_07245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QAY95556 LinkDB All DBs Position 1491261..1491509 Genome browser AA seq 82 aa AA seqDB search MTLTRTEIKNIVGETLGEILGDDEISLGDDTTADDVEDWDSTNHVRLIIALESRLGIQFQ TQEITSPETVGQLVDLIHKKLA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgactttgacacgaacggaaatcaaaaatatcgtcggcgagacgctaggcgaaattctc ggcgatgacgagatttcgttgggcgatgatacgacggctgacgatgtcgaagattgggac agcaccaatcatgtgcggctgatcatcgcattagaatcccgacttgggattcaatttcaa acgcaagagattacctctccggaaacggtagggcagctcgtggacttgattcataaaaag ctggcgtga

DBGET integrated database retrieval system