KEGG   Methylovirgula ligni: CWB41_11165Help
Entry
CWB41_11165       CDS       T05824                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mlg  Methylovirgula ligni
Pathway
mlg00473  D-Alanine metabolism
mlg00550  Peptidoglycan biosynthesis
mlg01100  Metabolic pathways
mlg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mlg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CWB41_11165
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CWB41_11165
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CWB41_11165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mlg01011]
    CWB41_11165
Enzymes [BR:mlg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CWB41_11165
Peptidoglycan biosynthesis and degradation proteins [BR:mlg01011]
 Precursor biosynthesis
  Amino acid ligase
   CWB41_11165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 GARS_A ATP-grasp_4 NAD_binding_8 CbiA
Motif
Other DBs
NCBI-ProteinID: QAY96218
LinkDB All DBs
Position
2299858..2300781
Genome map
AA seq 307 aa AA seqDB search
MKKHVAVLLGGFSAERDVSLRSGAACAKALAEQGFRVTPVDVDRNVGQVLAELKPDVAFN
ALHGPYGEDGVIQGVLEMLRIPYTHSGVLASALAMRKDRARDVLKAAGVPVAEGVSVDRL
TAARAHVLPPPYVVKPLAEGSSFGVLIVHQDHVHPPQELTREDWAYGDEVLVERYVAGRE
LTCAVIGDKAYDVIEIKAADGGWYDYNAKYAAGGSSHELPANLKQNIYHFVQELTLKAHK
ALGCRGVSRADFRYDDRPGGTGDLVILEVNTQPGMTATSLVPEIAAHAGLTFGELVKWMV
EDASCDR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcacgttgccgtcttgctgggcgggttttccgccgagagagacgtgtcgttg
cggtcgggggcggcctgcgccaaggcgctggccgagcaggggtttcgggttacgccggtc
gatgtcgatcgcaacgtcgggcaggttctcgccgaactcaagcccgacgtcgccttcaac
gccctgcatgggccctatggcgaagacggggtcatccagggcgttctcgaaatgctgcgg
attccctacacgcattccggcgtgctcgcctcggcgctggcgatgcgtaaggatcgcgct
cgggacgttctgaaggcggctggcgttccggtcgcggagggcgtgtcggtcgatcggctc
accgccgccagggcgcatgtcctgccgccgccctatgtcgtcaagccgctcgccgaaggc
tcatccttcggggttctcatcgtccatcaagaccacgtccatccgccccaggagttaacg
cgggaggattgggcctatggcgatgaggtgctcgtcgagcgctatgtcgcaggtcgcgaa
ttgacctgcgccgtcattggcgacaaggcctacgatgttattgaaattaaagccgcggac
ggcggttggtacgattacaacgccaaatatgccgcaggcgggtcgtcacatgaacttccg
gcgaatcttaaacaaaatatttaccactttgtccaagagttgaccctcaaggcgcacaag
gcgctcggatgccgcggcgtcagccgtgctgacttccgttacgacgatcgccccggaggt
acgggcgacctcgtgattttggaggtcaacacgcagcccggcatgaccgccacttcactt
gtgcccgaaatcgccgcacatgccggcctgacgttcggtgagctagtcaaatggatggtg
gaagacgcctcctgcgaccggtaa

DBGET integrated database retrieval system