KEGG   Mycobacterium liflandii: MULP_01355Help
Entry
MULP_01355        CDS       T02444                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mli  Mycobacterium liflandii
Pathway
mli00020  Citrate cycle (TCA cycle)
mli00190  Oxidative phosphorylation
mli00650  Butanoate metabolism
mli01100  Metabolic pathways
mli01110  Biosynthesis of secondary metabolites
mli01120  Microbial metabolism in diverse environments
mli01130  Biosynthesis of antibiotics
mli01200  Carbon metabolism
Module
mli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mli_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mli_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MULP_01355 (sdhB)
   00650 Butanoate metabolism
    MULP_01355 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MULP_01355 (sdhB)
Enzymes [BR:mli01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MULP_01355 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     MULP_01355 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_18 Fer4_15 Fer4_7 Fer4 Fer4_4 Fer4_2
Motif
Other DBs
NCBI-ProteinID: AGC61325
UniProt: L7V461
LinkDB All DBs
Position
complement(1458449..1459261)
Genome map
AA seq 270 aa AA seqDB search
MSLDTERASSDDVTDSLAPPLPPVPDGAVMVTVKIARFNPDAPEAFASTGGWQSFRVPCL
PSDRLLNLLIYIKGYLDGTLTFRRSCAHGVCGSDAMRINGVNRLACKVLMRDLLPKKSGK
QLTLTVEPIRGLPVEKDLVVDMEPFFDAYRAVKPYLITSGNPPTRERIQSPTDRARYDDT
TKCILCACCTTSCPVFWNEGSYFGSAAIVNAHRFIFDSRDEAAAERLDILNEVDGVWRCR
TTFNCTEACPRGIEVTKAIQEVKRALLFSR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtctttggacactgagagggcctcctccgacgacgtcaccgactcgctggccccaccg
ttgccgccggttccggacggtgcggtgatggtgacggtgaagatcgcgcggttcaacccg
gatgcccccgaggccttcgcatcgaccggcggctggcagagcttccgggtgccgtgcctg
cccagtgaccggctgctgaacctgctcatctacatcaagggctacctggacggcaccctg
accttccgacgttcctgcgcacacggagtgtgtggctccgacgccatgcggatcaacggc
gtgaaccggctggcctgcaaggtgctgatgcgtgacctgctgcccaagaaatcgggcaaa
cagctcaccctcaccgtcgaaccgatccgtgggctgccggtggaaaaagacctggtggtc
gacatggagccgttcttcgacgcgtatcgcgcggtgaagccctatctgatcaccagcggc
aacccgcccacccgggagcgcattcagagccccaccgaccgcgcccgctacgacgacacc
accaagtgcatcctgtgcgcgtgctgcaccaccagctgcccggtgttctggaacgagggc
agctacttcggctcggcggcgatcgtcaacgcgcaccgcttcattttcgacagccgtgac
gaggcggccgccgagcgactcgacatcctcaacgaggtcgacggcgtgtggcgctgccgc
accacgttcaactgcaccgaggcctgcccgcgcggcatcgaggtgaccaaggcgatccag
gaagtcaagcgggcgctgctgttctcccgctga

DBGET integrated database retrieval system