KEGG   Mycobacterium liflandii: MULP_01356Help
Entry
MULP_01356        CDS       T02444                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mli  Mycobacterium liflandii
Pathway
mli00020  Citrate cycle (TCA cycle)
mli00190  Oxidative phosphorylation
mli00650  Butanoate metabolism
mli01100  Metabolic pathways
mli01110  Biosynthesis of secondary metabolites
mli01120  Microbial metabolism in diverse environments
mli01130  Biosynthesis of antibiotics
mli01200  Carbon metabolism
Module
mli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mli_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mli_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MULP_01356 (sdhA)
   00650 Butanoate metabolism
    MULP_01356 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MULP_01356 (sdhA)
Enzymes [BR:mli01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MULP_01356 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     MULP_01356 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 DAO HI0933_like FAD_binding_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AGC61326
UniProt: L7V0N2
LinkDB All DBs
Position
complement(1459261..1461015)
Genome map
AA seq 584 aa AA seqDB search
MIQQHRYDVVIVGAGGAGMRAAVEAGPRVRTAVLTKLYPTRSHTGAAQGGMCAALANVED
DNWEWHTFDTVKGGDYLADQDAVEIMCKEAIDAVLDLEKMGMPFNRTPEGRIDQRRFGGH
TRDHGKAPVRRACYAADRTGHMILQTLYQNCVKHDVEFFNEFYALDLALTETPSGPVATG
VIAYELATGDIHIFHAKAIVLATGGSGRMYKTTSNAHTLTGDGIGIVFRKGLPLEDMEFH
QFHPTGLAGLGILISEAVRGEGGRLLNGEGERFMERYAPTIVDLAPRDIVARSMVLEVLE
GRGAGPHKDYVYIDVRHLGEDVLEAKLPDITEFARTYLGVDPVHELVPVYPTCHYVMGGI
PTTVTGQVLRDNTHVVPGLFAAGECACVSVHGANRLGTNSLLDINVFGRRAGIAAARYAR
GHDFVDMPAEPASMVVSWVADILSEHGNERVADIRGALQQTMDNNAAVFRTEETLKQALT
DIHALKERYSRITVHDKGKRFNSDLLEAIELGFLLELAEVTVVGALNRKESRGGHAREDY
PNRDDVNYMRHTMAYKEGTDLLSDIRLDFKPVVQTRYEPKERKY
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
ttgatccagcaacaccgatacgacgtggtgatcgtcggcgcgggcggtgccggcatgcgt
gcggcggtagaagcgggtccgcgggtccgcaccgcggtgctgaccaagctgtatccgacc
cgcagtcacaccggcgcggcccagggcggcatgtgcgccgcgctggccaacgtcgaagac
gacaactgggaatggcacacgttcgacaccgtcaagggcggcgactacctcgccgaccag
gacgccgtcgagatcatgtgcaaagaggccatcgacgcggtgctcgacctggaaaagatg
gggatgccgttcaaccgcacccccgagggccgcatcgaccagcgccgcttcggcgggcac
acgcgcgaccacggtaaggctccggtgcgccgggcctgctacgccgccgaccgcaccggg
cacatgatcctgcagacgctgtaccaaaactgcgtcaagcacgacgtggagttcttcaac
gagttctatgcgctcgatctcgcgctcaccgagaccccgagcggtccggtcgccaccgga
gtcatcgcctacgagctggcgaccggcgacattcacatcttccacgccaaggccatcgtc
ctggcgaccggcggttcgggccggatgtacaagaccacctcgaacgcgcacacgctgacc
ggtgatggcatcggcatcgtcttccgcaagggactcccgttggaggacatggagttccat
cagttccacccgaccggcctggccggcctgggcatcctgatctccgaggcggtacgaggc
gagggcggccggctgctcaacggcgaaggcgagcgcttcatggagcgctacgcccccacc
atcgtcgacctggcgccccgcgacatcgtcgcccgctcgatggtgctggaagtgttggag
ggccgcggcgccggtccgcacaaggactacgtctacatcgacgtccgccacctgggcgag
gacgtgctggaggccaagctgcccgacatcaccgagttcgcccgcacctatctgggggtg
gacccggtgcacgagctggtgccggtctatccgacctgccactacgtgatgggcggcatc
cccaccaccgtcaccggacaggtactgcgggacaacactcacgtcgttcccggcctgttc
gccgcgggtgagtgcgcctgcgtctcggtgcacggcgccaaccggctgggcaccaactcg
ctgctggacatcaatgtgttcggccgccgggccggtatcgccgcggctcgctacgcgcgc
gggcacgactttgtggacatgccggcggagccggcctcgatggtggtcagctgggtagcc
gacatcctgtccgagcacggcaacgagcgcgtcgccgacatccgcggtgccctgcagcag
accatggacaacaatgccgcggtgttccgcaccgaggaaaccctcaaacaggcactcacc
gacatccacgcgctcaaggagcggtattcccgcatcaccgtgcacgacaaggggaagcgg
ttcaacagcgatctactggaagccatcgaactgggctttttgctggagctggccgaagtc
accgtggtcggcgcattgaaccgcaaggagtcccgcggcgggcacgcccgcgaggactac
cccaaccgcgatgacgtcaactacatgcgccacaccatggcctacaaagaaggcaccgac
ctgctcagcgacatccggctggacttcaaacccgtcgtgcagacccgctacgaacccaag
gaacggaagtactga

DBGET integrated database retrieval system