KEGG   Mycobacterium liflandii: MULP_01380Help
Entry
MULP_01380        CDS       T02444                                 

Gene name
glpD2
Definition
(GenBank) glycerol-3-phosphate dehydrogenase GlpD2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mli  Mycobacterium liflandii
Pathway
mli00564  Glycerophospholipid metabolism
mli01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mli00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MULP_01380 (glpD2)
Enzymes [BR:mli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MULP_01380 (glpD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA NAD_binding_8 3HCDH_N HI0933_like Pyr_redox Thi4 AlaDh_PNT_C Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AGC61350
UniProt: L7V489
LinkDB All DBs
Position
1484752..1486509
Genome map
AA seq 585 aa AA seqDB search
MSNPTDASQRDQTGPAGSLGPEQRALAWERLGAEQFDVVVIGGGVVGSGCALDAATRGLK
VALIEARDLASGTSSRSSKMFHGGLRYLEQLEFGLVREALFERELSLTTLAPHLVKPLPF
LFPLTKRGWERPYIAAGIFLYDRLGGAKSVPAQKHLTRAGALRLSPGLKRSSLIGGIRYY
DTVVDDARHTMTVARTASHYGAVVRCSTQVVALLREGDRVVGVRVRDSEDGSITEVRGHV
VVNATGVWTDEIQALSKQRGRFQVRASKGVHVVVPRDRIVSDVAMILRTEKSVMFIIPWG
SHWIIGTTDTDWNLDLAHPAATKADIDYILGTVNAVLATPLTHADIDGVYAGLRPLLAGE
SDDTSKLSREHAVAVPAAGLVAIAGGKYTTYRVMAADAIDAAVQFVPARVAPSITEKVSL
LGADGYFALVNQVEHVGEMVGLHPYRVRHLLDRYGSLINEVLELAADDPDLLTPIKEAPG
YLKVEALYAVTAEGALHLEDILARRMRVSIEYPHRGVDCAREVADVVAPVLGWTVEDIER
EVANYKARVEAEVLSQAQPDDVSADMLRASAPEARAEILEPVPLN
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaatccgaccgacgcatcgcagcgtgaccagaccgggcccgccggttcgctgggg
cccgagcagcgcgcgttggcctgggagcggctcggtgccgagcagttcgatgtggtggtt
atcggcggcggggtagtgggctccgggtgtgcgctggacgccgccacccgcgggctgaag
gtggccctgatcgaagcccgcgatctggcctctggcacgtcgagccgttcgtcgaagatg
ttccacggtggactgcgttacctcgaacaactggaattcggcctggtgcgcgaagccctt
ttcgagcgggagctgtcgctgaccacgttggcgccgcatctggtcaagcccctgccgttt
ctgttcccgctcaccaagcgtggctgggaacgtccctacattgccgccgggatcttcctc
tacgaccgcctcggcggcgcgaaatcggttcccgcgcagaagcatttgacccgtgccggc
gcgttgcggctgagcccgggcctcaaacgcagctccctgatcggcggtatccgctactac
gacaccgtcgtcgacgatgccaggcacaccatgacggtcgctcgtaccgcgtcgcactac
ggggcggtcgtccgttgttccacccaggtggtagcgctgctgcgcgagggcgaccgggtg
gtcggggtgcgggtgcgcgattccgaggacggctcgatcaccgaggtccgcgggcacgtg
gtggtcaatgccaccggggtctggaccgacgagattcaggcgctgtccaagcaacgcggg
cgattccaggttcgagcgtccaagggtgtgcacgtggtggtgccccgggaccgcatcgtc
agcgacgtcgcgatgatcctgcgcaccgagaagtcggtcatgttcatcattccgtgggga
agccactggatcatcgggactaccgacaccgactggaacctggacctggcccaccccgcg
gccaccaaggccgacatcgactacatcctgggaacggtcaatgcggtgctggccacgccc
ctgacgcatgccgacatcgacggcgtgtacgccggtctgcggccgctgctggccggggag
agcgacgacacgtccaagctgtcgcgcgagcacgctgtggcggtaccggcggcagggctg
gtggccatcgccggcggcaagtacaccacctaccgggtgatggcggccgacgcgatcgac
gccgccgtgcagttcgttccggcccgggtggcgccgtcgatcaccgagaaggtcagcctg
ctgggcgccgacggctactttgcgctggtcaaccaggtggaacacgtcggcgagatggtc
ggcctgcacccctaccgagtgcgtcacctattggaccgctacggatcgctgatcaacgag
gtgctggaactggcggccgacgatccggacctgctgacgcccatcaaggaggctcctggc
tacctcaaggtggaggccctctacgccgtcaccgccgagggcgcgctgcatctggaagac
atcctggcccgccgcatgcgagtctccatcgagtacccgcaccgaggtgtcgattgcgcc
cgtgaggtggccgacgtggtcgcaccggtgctcgggtggaccgtcgaggacatcgagcga
gaagtcgcgaactacaaggcgcgggtggaagcggaggtcttgtcgcaggcccagcccgac
gacgtatcggcggacatgttgcgggccagcgcacccgaggcgcgtgccgagatcctcgag
ccggtgccgctgaattga

DBGET integrated database retrieval system