KEGG   Mycobacterium liflandii: MULP_01835Help
Entry
MULP_01835        CDS       T02444                                 

Definition
(GenBank) transferase
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
mli  Mycobacterium liflandii
Pathway
mli00500  Starch and sucrose metabolism
mli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MULP_01835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mli01003]
    MULP_01835
Enzymes [BR:mli01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MULP_01835
Glycosyltransferases [BR:mli01003]
 Polysaccharide
  Storage polysaccharide
   MULP_01835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_transf_5 Glyco_trans_4_4 Glyco_trans_1_2 Glycogen_syn NmrA
Motif
Other DBs
NCBI-ProteinID: AGC61749
UniProt: L7V8K4
LinkDB All DBs
Position
complement(1953897..1955276)
Genome map
AA seq 459 aa AA seqDB search
MACSGLWTHEGCPSERAGDRRACAAVQRHAAAADILCTFVEGATFMKILMVSWEYPPVVI
GGLGRHVHHLATALVAAGHEVVVLSRRPSGTDPSTHPPSDLISEGVRVIAAAQDPHEFSF
GSDMMAWTLAMGHAMVRAGLTLSGPGAEQPWQPDIVHAHDWLVAHPAIALADYYDVPMVS
TIHATEAGRHSGWVSGDLSRQVHAVESWLVRESDSLITCSGSMSDEITELFGPGLAETAV
IRNGIDAARWPFAVRKPRTGPPELLYVGRLEYEKGVHNAIAALPRIRRAHPGTTLTIAGE
GTQQDWLVEQARKHRVLKATKFLGHLEHAELLTLLHRADAAVFPSHYEPFGLVALEAAAA
GTPLVTSNIGGLGEAVIGGVTGVSCPPRDVAALAAAVCGVLDDPAAAQQRARAARERLNS
DFDWQTVAEQTAQVYLAAKRGERQPLPRLPIVEHALPDR
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcctgttcggggctctggacgcacgaaggctgcccaagtgagcgcgccggcgaccga
cgagcgtgcgcggctgtacagcgacacgccgctgcggccgacattttgtgcacgttcgtg
gagggggccacgttcatgaagatcctgatggtgtcgtgggagtacccaccggtggtgatc
ggcgggctcggccgccatgtccaccacctcgccaccgcattggtcgcggccggccacgaa
gtcgtggtgctgtcccgccggccctcgggcaccgaccccagcacccacccaccgtctgat
ctgatcagcgagggagtccgggtgatcgcggccgcgcaggatccgcacgaattcagcttc
ggtagcgacatgatggcttggaccctggccatgggtcacgccatggtccgggccggcctt
accctcagcggtcccggcgcggagcaaccctggcaacccgacatcgtgcacgcgcatgac
tggctggtggcacatccggcgattgcgctcgccgactactacgacgtgccaatggtttcc
acgattcatgcgaccgaagccgggcggcattccggttgggtttcgggagatctgagtcgc
caggtgcacgcggtcgaatcctggctggtgcgtgaatccgattcgctgatcacatgttcg
ggatcgatgagcgatgagatcaccgagctgttcggcccagggctggccgaaacggcggtg
attcgcaacggtatcgacgcggcgcgctggccttttgcggtccgtaaaccacgcaccggg
ccaccggaactgctctacgtcggtcggctggagtacgagaagggtgtgcacaatgccatt
gccgcactgccgcggatcaggcgcgcgcacccaggcaccacacttaccatcgccggcgaa
ggcacccaacaggattggctggtcgagcaggcacgcaaacaccgggtgctcaaggccacc
aagttcctgggccacctcgagcacgccgaactgctgaccctgctacatcgggccgacgcc
gcggtgttccccagccactacgagccgttcggactggtcgcgctggaggccgccgcggcc
ggaacaccgttggtgacgtcgaatatcggcgggttgggcgaagcggtgatcggcggggtc
accggggtatcgtgcccaccccgcgacgtggcggcgctggccgccgcggtgtgcggtgtg
ctcgatgatccggccgccgcgcagcaacgtgcccgggccgcgcgggaacggctcaactcc
gacttcgattggcagaccgtggccgagcagaccgcgcaggtgtacctggcggccaagcgc
ggagaacggcagccgctgccccggttgccgatcgtcgagcacgcgctgcctgatcgctag

DBGET integrated database retrieval system