KEGG   Mycobacterium liflandii: MULP_03874Help
Entry
MULP_03874        CDS       T02444                                 

Definition
(GenBank) acyl-CoA dehydrogenase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
mli  Mycobacterium liflandii
Pathway
mli00071  Fatty acid degradation
mli00410  beta-Alanine metabolism
mli00592  alpha-Linolenic acid metabolism
mli00640  Propanoate metabolism
mli01040  Biosynthesis of unsaturated fatty acids
mli01100  Metabolic pathways
mli01110  Biosynthesis of secondary metabolites
mli01200  Carbon metabolism
mli01212  Fatty acid metabolism
Module
mli_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MULP_03874
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MULP_03874
   00592 alpha-Linolenic acid metabolism
    MULP_03874
   01040 Biosynthesis of unsaturated fatty acids
    MULP_03874
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MULP_03874
Enzymes [BR:mli01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     MULP_03874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-ProteinID: AGC63493
UniProt: L7VAL8
LinkDB All DBs
Position
4191819..4193762
Genome map
AA seq 647 aa AA seqDB search
MAPDMTNTAKHLRDALDGRFRDVKNEMRQQLTLEIFRPHYTPNTVIARAKVAEQMKFMAG
AGAAEDSFRKEHGGTGNVGAAITMIEMLAMSDLSLMVKAGVQWGLFGGAVENLGTERHHE
QYVPKIIDLQLRGCFAMTETGHGSDVQSLETTATYDADTEEFIIDSPTPTARNDYIGGAA
ETATIAAVFAQLITQIDGEQANHGVHCFLVPIRDEDGNDLPGVTTSDCHYKGGLPGVDNG
RITFDHVRIPRVNLLNRYGDVATDGTYSSPIDNPNRRFFTMIGTLIRGRVTVGGSAAAAA
RVALDIATRYALQRRQFSAPDDDDTEVLIMDYLMHQRRLFPLIARSYALQFAQNELVSKC
HDLQTTDSPDAEEQRELEARAAGLKAANTWHASRAIQEAREACGGAGYMAENRLIALRAD
TDVFTTFEGDNHVLTQLVAKELLTAYADDIRSMSPVEWVRFAANAVGDRVMKRTAAEAIM
QRIVDARQDNEEEGSLFNRGTQVKMFEDREDYLLSSVARRLQNKSNEMSAFDAFNAVQDH
VLHAAQAHIDRVVLEAFVAGIESCTDKQARELLGVVCDLYALSVIEEDKAWYIEHRYLST
ERAKAVTRGINDRCRVLRPHARTLVDGFGIPKPLRYAEMLHPENLPD
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggacatgaccaacacagccaaacatctgcgcgacgccctcgacggccggttc
cgcgacgtgaaaaacgagatgcggcagcaactgaccctggagatattccggccgcactac
acaccgaacaccgtcatcgcgcgcgccaaggttgccgaacagatgaaattcatggccggg
gcgggagcggccgaggacagcttccgcaaagaacatggcggcaccggcaatgtgggtgcg
gccatcaccatgatcgagatgctggcgatgtcggacctgtcgctgatggtcaaggcgggc
gtccaatggggactgttcggcggcgcggtcgaaaatctgggcaccgagcgccaccacgaa
cagtacgtcccaaagatcattgacctgcagctgcgcggctgcttcgcgatgaccgagacc
ggacacggcagcgatgtccagtcactggaaaccacggcgacctacgacgccgataccgag
gagttcatcatcgactccccgacccctaccgcccgcaacgactacatcggcggcgcggcc
gaaaccgcaaccatagcagcggttttcgcgcagctgatcactcagatcgacggcgaacaa
gccaatcacggggtgcactgtttcttggttccgatccgcgacgaggacggcaacgatctg
ccaggtgtgacgacctcggactgccactacaagggtgggctgccgggcgtcgacaacggc
cgcatcacctttgatcacgttcggattccccgggtgaacctgctgaacaggtacggcgac
gtggccaccgacggcacctacagctcgccgatcgacaatcccaaccgcaggttcttcacc
atgatcggcacgctgatccgtggccgggtcaccgttggcggcagcgcggccgcggccgct
cgggttgcgctggacattgccacccgatatgcgttgcagcgcaggcagttcagtgcaccc
gatgacgacgacaccgaagtgctgatcatggactacctgatgcaccagcgcaggctgttc
ccgctgatcgcgcgttcgtatgcgctgcagttcgcacagaacgaactggtgtcgaaatgt
catgacctgcagacaacggactcccccgacgccgaagagcagcgcgaactggaggctcgc
gccgccggcctgaaggccgccaacacctggcacgccagccgtgccattcaggaagcgcgc
gaagcgtgcggcggcgccggctacatggccgagaatcggctgatcgcgttgcgggccgac
accgacgtgttcaccacgttcgaaggcgacaaccacgtgctgacccaactggtcgccaag
gagctgctcaccgcgtacgccgacgacatccgcagtatgagcccggtcgagtgggtgcgt
ttcgcggccaacgcggtcggcgaccgggtgatgaagcgcaccgcggccgaagcgatcatg
cagcgcatcgtcgacgcccgccaggacaacgaagaagaaggcagcctgttcaaccgcggc
acccaagtcaagatgttcgaagatcgcgaagactatctgttgtcctcggtggctcggcgg
ctgcagaacaaatccaacgagatgtcggcgtttgatgccttcaacgcggtccaggaccac
gtgctccatgccgcgcaggcccatatcgaccgggtggttctcgaggctttcgtcgccggc
atcgagtcatgcaccgacaagcaggcccgcgagctattgggggtcgtctgcgacttgtac
gcgttgtcggtaatcgaggaagacaaggcgtggtacatcgagcaccggtacctctcgacc
gaacgcgccaaggcagtcacccggggcatcaacgatcgatgccgggtgctgcgcccgcac
gccaggacgctggtggacggtttcggcatcccgaagcccctgcgttacgccgagatgctg
catcccgagaatcttcctgactga

DBGET integrated database retrieval system