KEGG   Mycobacterium liflandii: MULP_04137Help
Entry
MULP_04137        CDS       T02444                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
Organism
mli  Mycobacterium liflandii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGC63733
UniProt: L7VBA5
LinkDB All DBs
Position
4516731..4518221
Genome map
AA seq 496 aa AA seqDB search
MTADSTHRSFDELFIGGRWCKPTIAEPITVISPHSEEAIGRAPAAGPDEVEAAVAAARRA
FDYGPWPRLDPGERIRKVEELAAIYASHLDDMADLITAEMGSPHSFSRLGKAAGAAGLMQ
LALAAGRNFPWVERRQGIRGQAHLRRAPVGVVGAIVPWNVPQFLIMPKLIPALIAGCTVI
IKPAPETPLDALWLAEMIEQIELPEGVVSVLPGGPTVGEALVRHPGVDKIAFTGSSATGR
RIAALCGEGLKRVSLELGGKSAAIILDDADVGKTVAGLKTAGLMNNGQACVAQTRILVSE
RRHDEVVDALADMMSALQVGDPADEKTHVGPLVAQRQQRRVRDYIRSGQQEGARIVLGGQ
DNPQDRGWYVRPTLFTDATNDMRIAREEIFGPVLTVLTYRDEQDAIRIANDSDYGLAGSV
WTADTAHGLEIAAAVRIGTYGINMYTLDISAPFGGFKQSGIGREFGPEGLAEYVELQTVL
CSGKMPPLKGFEEPAG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacggccgattccacgcaccgttcgtttgacgagctgttcatcggtggacgctggtgc
aaacccaccatcgcggagccgatcaccgtgatttccccacactcggaggaggcgattggg
cgggccccggcggctggccccgacgaagtcgaggcggccgtggccgccgcccggcgcgcc
ttcgactacggtccgtggccacggctggatccgggtgagcggatacgcaaagtcgaagag
ttggccgcgatctacgcgagccacctcgatgacatggctgacctgatcaccgcggaaatg
ggctcgccgcacagtttcagcaggctgggcaaagcggccggagcagcgggcctgatgcag
ctggcactggcggcgggccgcaacttcccctgggtggagcggcgccagggaatacgcgga
caggcgcacctgcgtcgggccccggtcggggtagtcggggcgattgtgccgtggaacgtg
ccgcaattcctcatcatgcccaagctgatccccgcactgatcgccggttgcaccgtgatc
atcaagccggctcccgaaacccccttggacgctttgtggttagccgagatgatcgaacag
atcgagctacccgagggcgtcgtatcggtgcttcccggcggaccgacggtcggcgaggcg
ctggttcgccatcccggggtcgacaagatcgcgttcaccgggtccagcgccacgggccgt
cggatcgccgccctgtgcggcgaaggactcaaacgggtgagcttggagctgggcggaaaa
tccgcggcgataatcctcgacgacgccgacgtcggcaagaccgtcgccgggttgaaaaca
gcaggattgatgaacaacgggcaggcctgcgttgctcagacccgcatcctggtgagcgaa
cgccgtcacgacgaagtcgtcgacgccctggccgacatgatgtcggcgctgcaggtcggc
gatcccgccgatgagaagacccacgtcgggcccctggtcgcgcagcgacaacaacgtcgg
gttcgtgactacattcgctccggtcagcaggaaggcgcacgcatcgtgctcggcggccag
gacaacccacaggaccgcggctggtatgtgcggcccaccctgttcaccgacgccaccaac
gacatgcgcatcgcccgggaggagatattcggaccggtcctgactgtcctgacctaccgg
gatgaacaggacgcgatccggatcgccaacgacagcgactacggcctggccggttcggtg
tggaccgccgataccgcgcacggactcgaaatcgccgcggcggtgcgtatcggcacctat
ggcatcaacatgtacacgctggacatcagcgcaccattcggcgggttcaagcagtcgggc
atcgggcgtgagttcggacccgaggggcttgccgaatacgtcgagctgcagacggtgctg
tgtagcggaaaaatgccaccactcaagggctttgaggaacctgcagggtga

DBGET integrated database retrieval system