KEGG   Mycobacterium liflandii: MULP_05676Help
Entry
MULP_05676        CDS       T02444                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mli  Mycobacterium liflandii
Brite
Enzymes [BR:mli01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MULP_05676 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGC65060
UniProt: L7VEP7
LinkDB All DBs
Position
6107145..6107768
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVTKLEEARAKEDHSTIL
LNEKNLAFNLAGHVNHTIWWKNLSPNGGDKPTGELAAAIDEAFGSFDKFRAQFHAAATTV
QGSGWAALGWDTLGNKLLIFQVYDHQTNFPLGIVPLLLLDMWEHAFYLQYKNVKVDFAKA
FWNVVNWADVQSRYDAATSKTRGLIFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaatacaccttgcccgatttggactgggactacggagccctggaaccccacatc
tcaggtcagatcaacgagcttcaccacagtaagcaccacgccacctacgtcaagggtgcc
aatgacgccgtcaccaaactcgaggaagcgcgcgctaaggaagaccactcgacgatcctg
ctgaacgagaagaacctcgctttcaacctcgccggccacgtcaaccacaccatctggtgg
aagaatctctcccccaacggtggcgacaagcccaccggtgaactcgccgcggccatcgat
gaggcgttcgggtcgttcgacaagtttcgggcccagttccacgccgccgcgaccacggtg
caggggtcgggttgggcagcgctgggctgggacaccctcggcaacaagctgctgatcttc
caggtctacgaccaccagaccaacttcccgctgggcattgtcccgctgctgctgctcgac
atgtgggagcacgcgttctacctgcagtacaagaatgtgaaggtcgacttcgccaaggcc
ttctggaatgtcgtcaactgggccgacgtacagtcgcgctacgacgccgccacctcgaaa
actcgaggattaatcttcggctga

DBGET integrated database retrieval system