KEGG   Mycolicibacterium litorale: B1R94_00130Help
Entry
B1R94_00130       CDS       T05032                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mll  Mycolicibacterium litorale
Brite
KEGG Orthology (KO) [BR:mll00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mll01001]
    B1R94_00130
Enzymes [BR:mll01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     B1R94_00130
Protein kinases [BR:mll01001]
 Serine/threonine kinases: Other
  Bacterial family
   B1R94_00130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Seadorna_VP7 WaaY Kinase-like Kdo Neur_chan_memb
Motif
Other DBs
NCBI-ProteinID: AQT77984
UniProt: A0A1U9PAB5
LinkDB All DBs
Position
complement(26163..28043)
Genome map
AA seq 626 aa AA seqDB search
MTTPQHLSDRYELGEILGFGGMSEVHMARDTRLHRDVAVKVLRADLARDPSFYLRFRREA
QNAAALNHPAIVAVYDTGEAETSNGPLPYIVMEYVDGVTLRDIVHTDGPMPPRRAIEIIA
DACQALNFSHQHGIIHRDVKPANIMISKTGAVKVMDFGIARALADAGNSVTQTAAVIGTA
QYLSPEQARGEPVDARSDVYALGCVLYEILTGQPPFVGDSPVAVAYQHVREDPVPPSQKH
PGISPELDAVVLKALAKNPDNRYQTAAEMRTDLVRVHNGESPEAPKILSAAERTSMLSAA
PRPAHGDHTEQMPRPGTAVDTDRAGGSIGRWLIVVAVLAVLTVVVTVAINMVSGNPRNVQ
VPDVRGQSQQDAVATLQNKGFKIRTQQKPDNTIAPQMVIGTDPPANSMAAAGDEITINVS
YGPEQREVPDCTGGISYADCVKKLKDAGFGKFKESMSPSTPDQKDKVLSTIPPANQSAAI
TNEITVVVGNGPQTAEVPVVAGQTVDVAQQILTASGFLKTLPVPTDSPEPSGQVVGTDPP
NGQTVPQDTVIQIQVSKGNQFVMPDVRGMFWTDAEPRLRGLGWTGDLDKGADVQNSGQPS
HAVVTQSPAPQTPVNKDAIITLSFAS
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccacagcacctgtccgaccgctacgagttgggcgagatcctcggcttcggc
ggcatgtccgaggtgcacatggctcgcgacacccgcctgcaccgcgacgtcgccgtcaag
gtgctgcgcgccgacctggcccgcgacccgagcttctacctgcggtttcgccgggaggcg
cagaacgccgccgccctgaaccatcccgcgatcgtggcggtctacgacaccggtgaggcc
gagaccagcaacggaccgctgccctacatcgtgatggagtacgtcgacggcgtgaccctg
cgcgacatcgtgcacaccgacggcccgatgccgccgcggcgggccatcgagatcatcgcc
gacgcctgccaggccctgaacttcagccaccagcacggcatcatccaccgcgacgtcaag
ccggccaacatcatgatctccaagaccggcgcggtgaaggtgatggatttcgggatcgcg
cgagcgctggccgacgccggcaacagcgtcacccagaccgccgcggtgatcggcaccgcc
caatacctctcgccggaacaggcgcgcggcgagccagtcgacgcccgctccgacgtctac
gccctgggctgcgtgctctacgagatcctgaccggccagccgccgttcgtgggggattcg
ccggtggcggtggcctaccagcatgtccgcgaggatccggtgccgccgtcgcagaaacac
ccgggcatctccccggagctggacgccgtcgtgctcaaggcgctggccaagaaccccgac
aaccggtaccagaccgccgccgagatgcgcaccgacctggtgcgggtgcacaacggcgaa
tcacccgaagcgcccaagattctcagcgccgctgagcggacgtcgatgctgtcggccgcc
ccgcggcccgcgcacggcgaccacaccgagcagatgccccgccccggcaccgccgtcgac
accgatcgcgccggcggctcgatcggccgctggctgatcgtggtcgcggtgctggcggtg
ctgaccgtggtggtgacggtcgcgatcaacatggtcagcggcaatccgcgcaacgtccag
gtgccggatgtgcgcggccagtcccagcaggacgcggtcgccacgctgcagaacaagggc
ttcaagatccgcacccagcagaagccggacaacaccatcgctccgcagatggtcatcggg
accgatccgccggccaattcgatggccgccgccggcgacgagatcaccatcaacgtgtcc
tacgggcccgagcaacgcgaggtacccgattgcaccggcggcatcagctacgcggactgt
gtcaagaaactcaaggacgccgggttcgggaagttcaaggagtcgatgtcaccatcgacg
ccggaccagaaagacaaggtgctgtccaccatcccgcccgccaatcagagcgcggcgatc
accaacgagatcaccgtcgtcgtcggcaatggaccgcagaccgccgaggttccggtggtg
gccggccagaccgtcgacgtcgcccagcagatcctcaccgcgtccggcttcctcaagacg
ctgccggtacccaccgacagccctgagccgtccggccaggtggtcggcaccgacccgccc
aacggacagacggtgccccaggacacggtgatccagatccaggtgtccaagggcaaccag
ttcgtcatgccggacgtccgaggcatgttctggaccgacgccgagccgcggctacgcggg
ctgggctggaccggggacctggacaagggggccgacgtgcagaacagcggtcaaccgtcg
cacgccgtcgtcacccagagcccggctcctcagacgccggtgaacaaggacgcgatcatc
accctcagcttcgcgtcgtag

DBGET integrated database retrieval system