KEGG   Mycolicibacterium litorale: B1R94_01660Help
Entry
B1R94_01660       CDS       T05032                                 

Definition
(GenBank) fumarate reductase/succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mll  Mycolicibacterium litorale
Pathway
mll00020  Citrate cycle (TCA cycle)
mll00190  Oxidative phosphorylation
mll00650  Butanoate metabolism
mll01100  Metabolic pathways
mll01110  Biosynthesis of secondary metabolites
mll01120  Microbial metabolism in diverse environments
mll01130  Biosynthesis of antibiotics
mll01200  Carbon metabolism
Module
mll_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B1R94_01660
   00650 Butanoate metabolism
    B1R94_01660
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    B1R94_01660
Enzymes [BR:mll01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     B1R94_01660
    1.3.5.4  fumarate reductase (quinol)
     B1R94_01660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like Thi4 GIDA Pyr_redox_3 Lycopene_cycl FAD_oxidored AlaDh_PNT_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AQT78216
UniProt: A0A1U9PAU4
LinkDB All DBs
Position
complement(357967..359892)
Genome map
AA seq 641 aa AA seqDB search
MTVEVERHSYDVVVIGAGGAGLRAVIEARERGLKVAVVTKSLFGKAHTVMAEGGCAAAMR
NVNTKDSWQVHFGDTMRGGKFLNNWRMAELHAQEAPDRVWELETYGALFDRTKDGKISQR
NFGGHTYPRLAHVGDRTGLEIIRTLQQKIVSLQQEDKKELGDYEARIKVFHECSITDLIK
DGDAIAGAFGYYRETGKFVLFETPAVVLATGGIGKSFKVSSNSWEYTGDGHALALRAGSG
LINMEFIQFHPTGMVWPLSVKGILVTEGVRGDGGVLKNSEGKRFMFDYIPDVFKGQYAET
EEEADQWLKDNDSARRTPDLLPRDEVARAINDEVKAGRGTPHGGVYLDIASRMPAEEIKR
RLPSMYHQFIELAEVDITKDMMEVGPTCHYVMGGIEVDPDTGAGSTPGLFAAGECSGGMH
GSNRLGGNSLSDLLVFGRRAGLGASDYVRALSQRPAVSDTAVEEAATLALSPFEPKDNAE
NPYTLHAELQQSMNDLAGIIRKEGELQEALVKIDELKKRYANVVVEGGRIFNPGWHLAID
MRNMLLVSECVAKAALQRTESRGGHTRDDFPKMDAAWRNKLLVCRVSAANAAGDTAVVPD
VEVTPEQQPVMRPDLLATFELSELEKYYTDDQLAEHPDRKG
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgacggtggaagtcgaacggcattcctacgacgtggtcgtgatcggtgccggcggcgcg
ggcctgcgagcggtgatcgaggcccgggaacggggcctgaaagtcgccgtcgtcaccaag
tccctgttcggcaaggcacacacggtgatggccgaaggcggctgtgctgcggcgatgcgc
aacgtcaacaccaaggacagctggcaggtgcacttcggtgacaccatgcgcggaggcaag
ttcctcaacaactggcggatggctgagctgcacgctcaagaagcccccgaccgggtgtgg
gagctggagacctacggtgcgctgttcgaccgcaccaaagacggcaagatcagccagcgc
aacttcggcgggcacacctacccgcggctggcccacgtcggcgaccgcaccggcctggaa
atcattcgcaccctgcagcagaagatcgtctcgctgcagcaggaggacaagaaggaactc
ggcgactacgaagcccggatcaaggtcttccacgagtgctcgatcaccgatctgatcaag
gacggtgatgcgatcgcgggcgccttcggctactaccgcgagaccggcaaattcgttctc
ttcgagacgccggcggtggtgctggccaccggcggcatcggcaagtccttcaaagtgtcg
tcgaactcctgggagtacaccggcgacggccacgcgctcgcgctgcgcgcaggctccggc
ctgatcaacatggagttcatccagttccacccgaccggcatggtctggccgctgtcggtg
aagggcatcctggtcaccgagggtgtgcgcggtgacggcggtgtgctgaagaactccgag
ggcaagcgcttcatgttcgactacatccccgacgtgttcaaggggcagtacgccgagacc
gaggaagaagccgaccagtggctcaaggacaacgactccgcgcgtcgcacccctgacctg
ctgccgcgcgacgaggtggcccgcgccatcaacgacgaggtgaaggccggccgcggcacc
ccgcacggcggtgtctacctcgacatcgcctcccgcatgccggccgaggagatcaagcgc
cggctgccgtcgatgtaccaccagttcatcgagctggccgaggtggacatcaccaaggac
atgatggaggtcgggccgacctgtcactacgtgatgggcggtatcgaggtcgaccccgac
accggcgccggctcgacccccggcctgttcgccgcgggcgagtgctccggcggcatgcac
ggatccaaccgcctcggcggcaactcgctgtccgacctgctggtgttcggacggcgcgcc
ggactcggagcgtccgactacgtgcgggcactgtcgcaacggcccgcggtgtcggacacg
gcggtcgaagaggccgccacgctggcgctgtcaccgttcgagccgaaggacaacgccgag
aacccgtacacgttgcacgccgaactgcagcagtcgatgaacgacctcgcgggcatcatc
cgcaaggagggcgaactgcaggaggccctggtcaagatcgacgagctcaagaagcgctac
gccaacgtcgtggtcgagggtggtcgcatcttcaacccgggttggcacctggccatcgat
atgcgcaacatgctgctggtcagcgagtgcgtcgcgaaggccgcgctgcagcgcacggaa
agccgcggcgggcacacccgcgacgacttcccgaagatggacgccgcatggcgcaacaag
ctgctggtgtgccgggtaagcgcggcgaacgccgcgggagacacagccgtcgtgccggac
gtcgaggtgacaccagagcagcagcccgtgatgcggcccgatctgctggccacgtttgag
ctgtccgaactcgagaagtactacaccgacgatcaactggccgagcacccggaccggaag
ggctga

DBGET integrated database retrieval system