KEGG   Mycolicibacterium litorale: B1R94_01930Help
Entry
B1R94_01930       CDS       T05032                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
mll  Mycolicibacterium litorale
Pathway
mll00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:mll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B1R94_01930
Enzymes [BR:mll01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     B1R94_01930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AQT78258
UniProt: A0A1U9PB83
LinkDB All DBs
Position
complement(434933..436396)
Genome map
AA seq 487 aa AA seqDB search
MAGAVELRQLIAGQWRSGDGDAVASLNPSRPNIVVAEGGSATIADLDSAVAAACEARRGW
AGTPTHQRGAVLLDAAAIVDRNAEDWGLELAIEEGKTRAEGVGEVRRAAQILRYYGHEGD
RQAGEIFASPRAGEQILVTRKPVGVVGIITPFNFPIAIPAWKIAPALVYGNPVVWKPAST
VPLLAIRLADALNTAGLPAGVLNLVIGEAAIGDALVNHADVDAISFTGSTGVGRRIAAAA
AARGVPVQAEMGGKNAAVVLDDADVELALEQVMLGAFRSTGQKCTATSRLIVTEGIADRF
LTELAQRTGALAVGDPTDDATQMGPVITGTAQRGIYGSIGTAISQGGEVLAGGQPYTTGP
LADGFFVAPTIVELAGSGDIWVEELFGPVVAVRRAADADEAFALANDSEFGLSAAVFTQD
LTRALQAVDHVDVGVLHINSESAGADPHVPFGGAKKSGLGPKEQGTAAREFYTHTTTVYL
RGGRPLN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcgggagccgtcgaactccggcagttgattgccgggcagtggcgttcgggtgacggc
gacgcagtcgccagcctcaacccgtcccgtccgaatatcgttgtcgccgagggtggttcc
gcgacgatcgccgacctcgacagtgcggtggccgccgcatgcgaggcgcgtcgcggctgg
gcgggtacgccgacccaccaacgcggtgcggtgctgctggacgccgccgccatcgtcgac
cgcaatgccgaggactggggcctggaactggccatcgaggagggcaagaccagggccgaa
ggcgtcggcgaggtgcgccgggccgcacagatcctgcggtattacggtcatgagggtgac
cggcaggccggcgagatattcgcctcgccccgcgccggcgagcagatcctggtgacccgc
aagcccgtcggtgtcgtcgggatcatcaccccgttcaacttcccgatcgccatccccgcc
tggaagatcgcgcctgcgctggtgtacggcaacccggtggtgtggaagccggccagtacc
gttccgctgcttgctattcggctcgccgacgcactcaacaccgccggcctgcctgccggc
gtgctgaacctggtcatcggtgaggccgcgatcggggatgcgttggtcaaccacgccgac
gtcgacgcgatcagcttcaccggctccaccggagtcggccggcggatcgccgccgcggcc
gccgcgcggggggtgccggtgcaggccgagatgggcggtaagaacgccgcagtggtactc
gacgacgctgacgtcgaactggctctggagcaggtgatgctcggtgcgttccgctcgacc
ggtcagaagtgcacggccacatcccgattgatcgtgacagagggaatagccgaccgattc
ctgaccgagctcgcacagcggaccggcgcactggccgtcggcgatccgacagacgatgcc
acccaaatgggtccggtcatcaccggtaccgcccagcggggtatctacggcagcatcggc
acggcgatcagccaaggcggcgaggtgttggccggcggtcagccctacaccaccgggccg
ctggccgacgggttcttcgtggcgcccaccatcgtggaactggctgggtcgggcgatatc
tgggtcgaggagctgttcggcccggtcgtggcggtgcgccgcgcggccgatgccgacgag
gccttcgcgctggccaatgacagcgagttcggcctgtccgcggcggtgttcactcaggac
ctcacccgcgcactgcaggccgtcgaccacgtggatgtcggtgtgttgcacatcaattcc
gagtcggccggcgccgatccgcacgtgccgttcggcggggcgaagaagagcgggctgggc
cccaaagagcagggcaccgcagcgcgcgagttctacacccacaccacgacggtgtaccta
cgcggcgggcggccgctgaactga

DBGET integrated database retrieval system