KEGG   Mycolicibacterium litorale: B1R94_02750Help
Entry
B1R94_02750       CDS       T05032                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mll  Mycolicibacterium litorale
Pathway
mll00220  Arginine biosynthesis
mll00250  Alanine, aspartate and glutamate metabolism
mll00290  Valine, leucine and isoleucine biosynthesis
mll01100  Metabolic pathways
mll01110  Biosynthesis of secondary metabolites
mll01130  Biosynthesis of antibiotics
mll01210  2-Oxocarboxylic acid metabolism
mll01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mll00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B1R94_02750
   00290 Valine, leucine and isoleucine biosynthesis
    B1R94_02750
   00220 Arginine biosynthesis
    B1R94_02750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mll01007]
    B1R94_02750
Enzymes [BR:mll01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     B1R94_02750
    2.6.1.66  valine---pyruvate transaminase
     B1R94_02750
Amino acid related enzymes [BR:mll01007]
 Aminotransferase (transaminase)
  Class I
   B1R94_02750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AQT78386
UniProt: A0A1U9PBA5
LinkDB All DBs
Position
complement(585752..587050)
Genome map
AA seq 432 aa AA seqDB search
MDLHRGGRIVSVSTHQLPWHGTSHQPRQRTFTQSTKLQDVLYEIRGPIHEHANRLENEGH
RILKLNIGNPAPFGFEAPDVIMRDMIAALPYAQGYSDSKGIVSARRAVFTRYELVEGFPK
FDIDDVYLGNGVSELITMTLQALLDNGDQVLIPAPDYPLWTASTALAGGTPVHYLCDETQ
GWMPDIADLESKITDRTKALVVINPNNPTGAVYSREILQQMVEVARKHQLLLLADEIYDK
ILYDDAKHISLASLAPDLLTLTFNGLSKAYRVAGYRSGWLVITGPKEHASSFIEGISLLA
NMRLCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDAAWTKLNEIPGVSCVKPTGAL
YAFPRLDPEVHEIHDDEQLVLDLLLQEKILVTQGTGFNWPAPDHLRIVTLPWARDLTSAI
ERLGNFLASYRQ
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggatttgcaccggggtgggagaatcgtttctgtgagtactcatcagttgccgtggcac
ggcacgagccatcagccgcggcaacgcacgttcacacagtcgacgaagctgcaggacgtt
ctctacgagatccgcggcccgatccatgagcacgccaaccggttggagaacgagggtcat
cgcatcctcaagctcaacatcggcaaccccgcgccattcgggttcgaggcgcccgacgtc
atcatgcgcgacatgatcgccgccctgccctacgcccagggctattccgactccaagggc
atcgtcagtgcgcggcgtgcggtgttcacccgctatgaactggtcgagggattccccaag
ttcgacatcgacgacgtgtacctcggcaacggggtgtccgagctgatcacgatgacactg
caggcgctcctcgacaacggtgaccaggtactcatccccgcccccgactatccgctgtgg
accgcgtcgaccgcgctggccggcggcacacccgtgcactacctgtgcgacgagacccag
ggctggatgcccgacatcgccgacctggagtccaagatcaccgaccgcaccaaggcgctg
gtggtgatcaacccgaacaacccgaccggcgcggtgtacagccgcgaaatcctgcagcag
atggtcgaggtggcccgcaaacatcagttgctgctgctggccgacgagatctacgacaag
atcctctacgacgacgccaagcacatcagcctggcctcgctggcaccggatctgctgacg
ttgacgttcaacgggctgtccaaggcgtaccgggtcgccggctaccggtcgggctggctg
gtcatcaccggccccaaggaacacgccagcagcttcatcgaaggcatcagtctgctggcc
aatatgcggctgtgcccgaatgtgcctgcgcaacatgccattcaggtcgcgttgggtggc
caccagagcatcgaggacctggtgctaccgggcgggcggttgctcgagcagcgcgacgcc
gcgtggaccaagctgaacgagatccccggcgtgtcgtgcgtgaaaccgaccggcgcgctg
tacgccttcccgcgcctggaccccgaggtgcacgaaatccacgacgacgagcagttggtg
ctcgacctgctgttgcaggagaagatcctggtcacccagggcaccggcttcaactggccg
gccccggaccatctgcggatcgtgacgctgccgtgggcacgggacttgaccagtgcgatc
gaacggctgggcaacttcctggccagctaccgccagtaa

DBGET integrated database retrieval system