KEGG   Mycolicibacterium litorale: B1R94_11100Help
Entry
B1R94_11100       CDS       T05032                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
mll  Mycolicibacterium litorale
Pathway
mll00061  Fatty acid biosynthesis
mll00071  Fatty acid degradation
mll01100  Metabolic pathways
mll01212  Fatty acid metabolism
mll02024  Quorum sensing
Module
mll_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mll00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    B1R94_11100
   00071 Fatty acid degradation
    B1R94_11100
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    B1R94_11100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mll01004]
    B1R94_11100
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mll04147]
    B1R94_11100
Enzymes [BR:mll01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     B1R94_11100
Lipid biosynthesis proteins [BR:mll01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   B1R94_11100
Exosome [BR:mll04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   B1R94_11100
  Exosomal proteins of breast cancer cells
   B1R94_11100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: AQT79700
UniProt: A0A1U9PFD7
LinkDB All DBs
Position
complement(2371031..2372830)
Genome map
AA seq 599 aa AA seqDB search
MREFSVPASFTIGEHDSIVSSVYDHERDDPDYVILQRLVDGAWIDVTCAEAAAQIRSAAL
GLIAEGVNAGDRVAILSATRYEWVILDYAILSIGAVTVPIYETSSAEQVRWVLEDSGAVL
AITETEAHAQMVKELHDELPALRKTLRIESSGPTALDELAEGAAGVDPAELSRRLAELRA
TDPATLIYTSGTTGRPKGVALTHSNLLYETRGAGTCFPTLLRQHERLLVFLPLAHVLARA
LSMSAFANKVTLGYTSDIKNLVPMLQDFKPTIVVSVPRVFEKVYNTAELNARDSGKGKIF
ELAAKTAIAYSEALATGQPNLVLKLGHAIFDRLVYGKLRAALGGDCQAAISGGAPLGKRL
GHFYRGVGLSIYEGYGLTETSAAITVNRIGELKVGTVGKLMPGNAMTIAEDGELLVKGGV
VFGGYWHNEKATGEAIVDGWFHTGDLASIDAEGFLSITGRKKEIIVTAGGKNVAPAVLED
ALRAHPLISQAMAVGDNQPFIGALIAIDPEAFEVWKSHHGKAAEASVEDLRQDPDLIAEI
ELAIKDANQHVSHAESIRKFRILPCDFTVLTGELTPTLKVKRNVVADKFAEEIAAIYQR
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgagttcagcgttccggcgtcgttcaccatcggagagcacgacagcatcgtcagc
tccgtatacgaccacgagcgcgacgaccccgactatgtgatcctgcaacgactcgtggac
ggcgcgtggatcgacgtcacctgcgccgaggcggccgcccagatccggtcggccgcgttg
ggcctgatcgccgagggcgtcaacgccggggaccgggtggccatcctgtcggccacccgc
tacgagtgggtgatcctggactacgcgatcctctcgatcggcgcggtcaccgtgcccatc
tacgagacctcctcggccgaacaggtccgctgggtactggaggactccggcgcggtgctg
gcgatcaccgagaccgaggcacacgcccagatggtcaaggaactccacgacgagttgccg
gcgctgcgcaagacactgcgcatcgagtcctcgggcccgacggccctcgacgaactggcc
gagggcgcggccggcgtcgatcccgccgaactcagccgacgcctcgcagagctgcgcgcg
accgacccggccacgctgatctacacctccggcaccaccggcaggcccaagggcgtcgcg
ctcacccactccaacctgctctacgagacccgcggcgcgggcacctgtttccccaccctg
ctgcgccagcacgaacgactgctggtcttcctgccgctggcccatgtgctggcccgcgcc
ctgtccatgtcggcgttcgccaacaaggtgaccctcggctacaccagcgacatcaagaac
ctggtcccgatgctgcaggacttcaagccgacgatcgtggtctcggtgcctcgggtgttc
gagaaggtctacaacacagccgagttgaacgcccgcgacagcggcaagggcaagatcttc
gagctcgccgccaagacggccatcgcctacagcgaggcgctggccaccggccagcccaac
ctggtgctgaagctgggccacgccatcttcgaccggctggtctacggcaagctgcgggcg
gcgctcggcggggactgccaggccgcgatctccggcggtgcgccgctgggcaagcggctc
ggccacttctaccggggtgtcggcctgtcgatctacgagggctacgggctgaccgagacc
agcgcggcgatcacggtgaaccggatcggtgaactcaaggtcggcacggtcggcaaattg
atgccgggcaacgccatgacgatcgccgaggacggcgaactgctggtcaagggcggcgtg
gtgttcggtggctactggcacaacgagaaagcgaccggcgaggcgatcgtcgacggctgg
ttccacaccggcgatctggccagtatcgacgccgaagggttcctgtcgatcaccggccgc
aagaaggagatcatcgtcacggccggcggcaagaacgtcgcaccggcggtgctcgaggac
gcgctacgggcccacccgctgatcagccaggccatggccgtcggcgacaaccagccgttc
atcggggcgttgatcgccatcgatcccgaggcgttcgaggtgtggaagtcccaccacggc
aaggccgccgaggcctcggtggaggacctgcggcaggaccccgacctgatcgccgagatc
gagctggcgatcaaggacgccaatcagcatgtgtcgcatgccgagtcgatccgcaagttc
cgcatcctgccgtgcgatttcaccgtgttgaccggcgagctcaccccgacgctcaaggtc
aagcgcaacgtggtggccgacaagttcgccgaggagatcgcggcgatctatcagaggtag

DBGET integrated database retrieval system