KEGG   Mycolicibacterium litorale: B1R94_16685Help
Entry
B1R94_16685       CDS       T05032                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mll  Mycolicibacterium litorale
Pathway
mll00250  Alanine, aspartate and glutamate metabolism
mll00280  Valine, leucine and isoleucine degradation
mll00410  beta-Alanine metabolism
mll00640  Propanoate metabolism
mll00650  Butanoate metabolism
mll01100  Metabolic pathways
mll01120  Microbial metabolism in diverse environments
Module
mll_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    B1R94_16685
   00650 Butanoate metabolism
    B1R94_16685
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B1R94_16685
   00280 Valine, leucine and isoleucine degradation
    B1R94_16685
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B1R94_16685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mll01007]
    B1R94_16685
Enzymes [BR:mll01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     B1R94_16685
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     B1R94_16685
Amino acid related enzymes [BR:mll01007]
 Aminotransferase (transaminase)
  Class III
   B1R94_16685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AQT80554
UniProt: A0A1U9PHK5
LinkDB All DBs
Position
3532524..3533864
Genome map
AA seq 446 aa AA seqDB search
MTTLEQSRKLVTDIPGPGSVELTKRRVAAVSHGVGVTMPVYAARAAGGIIEDVDGNRLID
LGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFMVTPYEEYIAVAEHLNRLTPGSYEKRS
ALFNSGAEAVENAIKIARAYTHKSAVVAFDHAYHGRTNLTMALTAKSMPYKSGFGPFAPE
VYRAPMSYPYRDGLIDKEWATDGELAAERALSVIDKQIGAANLAAIIIEPIQGEGGFIVP
APGFLPALRAWCSDNGVVFIADEVQSGFARTGAMFACEDEGIEPDLIVSAKGIADGLPLA
AVTGRAEIMDAPHASGLGGTYGGNPVACAAALATIETIELDGLLDRAKHIESVMKDKLGR
MQADDDRIGDVRGRGAMIAVELVKSGSADPNPDLAKNLASRAHAQGVLVLTCGTFGNILR
FLPPLTISDDLLLEGLDVLAGILAEL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccctcgagcagagccgcaaactcgtcaccgacatacccggccccggatccgtc
gaactgaccaagcgccgggtcgccgcggtgtcgcacggcgtcggagtcaccatgccggtg
tacgccgcccgcgccgccggcggaatcatcgaggatgtcgacggcaacaggttgatcgac
ctcgggtccggcatcgcggtcacgacgatcggcaactcctccccgcgagtggtcgacgcc
gtgcgagcgcaagtggccgacttcacccacacctgcttcatggtgacgccgtacgaggag
tacatcgcagtcgccgagcatctcaaccgcctcacccccggctcctacgagaagcgctcg
gcgctgttcaactccggcgccgaagcggtggagaacgcgatcaagatcgcccgcgcctac
acccacaagagcgcggtcgtcgccttcgaccacgcctaccacggccgcacgaacctcacg
atggcgctgaccgccaagtcgatgccctacaagagcggcttcggcccgttcgcgccggag
gtctaccgggcccccatgtcctacccctaccgcgacggcctgatcgacaaggagtgggcc
accgacggcgaactggccgccgaacgggcgctgtcggtgatcgacaagcagatcggcgcg
gccaatctggcggcgatcatcatcgaacccattcagggcgagggtggcttcatcgtgccg
gctccgggcttcctgcccgcgctgcgcgcctggtgctccgacaacggcgtggtgttcatc
gccgacgaggtgcagtccgggttcgcccgcaccggagcgatgttcgcctgtgaggacgag
ggcatcgaaccggacctgatcgtcagcgcgaagggcatcgccgacggcctgccactggcc
gcggtcaccggccgcgccgagatcatggacgccccgcacgccagcggtctcggcggtacc
tacggcggcaacccggtggcctgcgccgcagcactggccaccatcgagaccatcgagctc
gacgggctgctcgaccgggccaagcacatcgaaagcgtgatgaaggacaagctcggccgg
atgcaggccgacgacgaccgcatcggcgacgtccggggccgtggcgcgatgatcgccgtg
gagctggtgaaatccggctcggccgacccgaacccggatctggccaagaacctcgcttcc
agagcgcacgcgcagggcgtgctggtactgacctgcggcacgttcggcaacatcctgcgt
ttcctgccgccgctgacgatcagcgacgacctgctcctggaaggactcgacgtgctcgcc
ggaattctcgccgagctctga

DBGET integrated database retrieval system