KEGG   Mycolicibacterium litorale: B1R94_18590Help
Entry
B1R94_18590       CDS       T05032                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mll  Mycolicibacterium litorale
Brite
Enzymes [BR:mll01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B1R94_18590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Sbi-IV
Motif
Other DBs
NCBI-ProteinID: AQT80844
UniProt: A0A1U9PIF8
LinkDB All DBs
Position
complement(3925730..3926347)
Genome map
AA seq 205 aa AA seqDB search
MTHYTLPDLDYDYGALEPHISGQINEIHHSKHHATYVKGANDAIAKLDEARASGDHSAIL
LNEKNLAFHLGGHVNHSIWWKNLSPNGGDKPTGELAAAIDDQFGSFDAFAAQFAAAANGL
QGSGWAVLGYDTLGRRLLTFQLYDQQANVPLAVIPLLQVDMWEHAYYLQYKNVKADYVTA
FWNVVNWDDVQARFASARAAEGLIF
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacgcactacacactgcccgacctcgattacgactacggcgcattggagccgcatatt
tcgggccagatcaacgagattcaccacagcaagcaccacgcgacgtatgtcaaaggcgcc
aacgacgcgatcgccaagctggacgaggcccgcgccagcggcgatcacagcgcgatcctg
ctcaacgagaagaacctggcgtttcacctcggcggccacgtcaatcacagcatctggtgg
aagaacctgtcgcccaacggtggtgacaagccaaccggcgagctcgccgcggcgatcgac
gaccagttcggctccttcgacgcctttgcggcccagttcgccgcggcggcaaacgggctg
caggggtcgggctgggcggtgctcggctacgacaccctgggccggcgcctgctcaccttc
cagctctatgaccagcaggccaacgtcccgttggctgtcattccgctgctccaggtggac
atgtgggaacacgcctattacctgcagtacaagaacgtcaaagccgactacgtcaccgca
ttctggaacgtcgtcaactgggacgacgtgcaggcccggttcgcctcggctcgcgcagcg
gagggcctgatcttctag

DBGET integrated database retrieval system