KEGG   Mycolicibacterium litorale: B1R94_20695Help
Entry
B1R94_20695       CDS       T05032                                 

Definition
(GenBank) AMP-dependent synthetase
Organism
mll  Mycolicibacterium litorale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AQT81154
UniProt: A0A1U9PJC0
LinkDB All DBs
Position
complement(4353877..4355526)
Genome map
AA seq 549 aa AA seqDB search
MKGAPAIEPRYATLTEMLDAAAYSDQSLIFVGRDEQDHPVSMADIRSHAHALAAGLRDAG
VRPGDRVALVLPTGPDFVASFFGVLVAGAIPVPLYPPVRLGKLAEYQSRTAAMLRAVQAA
LVVTDDRIRPALEAPVTDAGPRLGCVTAAALCRPGDVGHRAAADDAALIQFSSGSTHDPK
PVVLTHRNLLSNIAAIADYFTGHGMPDPVGVTWLPLYHDMGLIGNLLTAFYLPRPLVLLA
PEHFLAVPAAWLRAISRHRGTVTAAPNFAFGLCLKRIRDAELDGVDLSSWRLCLNGAEMI
SADVQRRFGDRFGRWGFEPSALTPVYGLAEASLAVTFKAAGAAPNVVAAPRPGAQDLVGT
GRPLAGVEIDIRDDDGSSLPEDSVGRIVVRGPSVMAGYYGRPDLTEQVLHDGWLDCGDIG
FLHGGELFVCGRSKETIVIRGANHAPQDFEAVLDAVPGVRTGCAVAVGYLPADAGEESLA
LLVETTPDAAPTLAQDVAAQVLARTGISAHHVELLAPGTLPRTSSGKLRRLEARSQWLAG
TLTPRRTPC
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
gtgaagggggcccccgcaatcgagcccaggtacgcgaccctgaccgagatgctcgacgcg
gccgcatactccgatcagagcctgatcttcgtcggccgtgacgagcaggaccacccggtg
tcgatggccgacatccgcagccacgcccacgcgctggccgccggcctgcgcgacgccggt
gtgcgccccggcgaccgggtcgccctggtgctcccgaccggaccggacttcgtcgcgtcg
ttcttcggggtgctcgtcgccggcgccatccccgtcccgctgtatccgccggtgcggctc
ggcaagctcgccgaatatcagagccgcaccgccgcgatgctgcgagctgtgcaggccgcc
ctggtggtcaccgacgaccggatccgtccggcgctcgaggcaccggtcaccgacgccggc
ccccggctggggtgcgtcaccgccgccgcgctatgccgcccgggcgacgtcggccaccgc
gccgctgccgacgatgcggcgctcatccagttttcctcgggcagcacgcacgatcccaaa
ccggtcgtgctgacccaccgcaacctgctgtccaacatcgccgccatcgcggactatttc
accggccacggcatgcctgacccggtcggcgtcacctggctgccgctctaccatgacatg
ggcttgatcgggaacctgctgaccgcgttctaccttccgcgcccgctggtgctgctggcg
cccgaacacttcctcgccgtgcccgcggcttggctgcgcgccatctcccggcaccgcggg
accgtcaccgccgcacccaacttcgccttcgggttgtgcctgaagcgaatccgcgacgcg
gaactcgacggcgtcgacctcagctcgtggcggctgtgcctcaacggggccgagatgatc
agcgccgacgtgcagcgccggttcggtgatcggttcgggcgctggggattcgaaccgtcg
gccctcaccccggtctacgggctggccgaagcgtcgctggcggtcaccttcaaagcggcc
ggcgccgcaccgaacgtggtcgccgcgccgcggcccggtgcccaggacctggtcggcacc
gggcggcccctggcgggcgtggagatcgacatccgcgacgacgacggctcatcgctgccc
gaggacagcgtgggacgcatcgtggtgcgcggacccagcgtgatggccggctactacggc
cgccccgacctcaccgaacaagtcctgcacgacggctggctcgactgcggcgacatcgga
ttcctgcacggcggtgagcttttcgtgtgcgggcgcagcaaagagaccatcgtcatccgc
ggtgccaatcacgcaccccaggacttcgaggcggtcctggacgcagtgcccggtgtccgc
accggatgcgcggtggcggtgggatacctgcccgccgacgcaggggaggaaagcctggcc
ctactggtcgagaccactcccgacgccgccccgaccctggcgcaggacgtcgcggcccag
gtgctggcccgcaccggcatcagcgcccaccacgtcgagctgttggcgccgggcacgctg
ccgcgcacgtcgagcggaaagctgcgccggctcgaggcccgtagccagtggctggccgga
acgctcaccccgcggaggacaccctgctag

DBGET integrated database retrieval system