KEGG   Mycolicibacterium litorale: B1R94_22285Help
Entry
B1R94_22285       CDS       T05032                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mll  Mycolicibacterium litorale
Pathway
mll00250  Alanine, aspartate and glutamate metabolism
mll00410  beta-Alanine metabolism
mll00430  Taurine and hypotaurine metabolism
mll00650  Butanoate metabolism
mll01100  Metabolic pathways
mll01110  Biosynthesis of secondary metabolites
mll01120  Microbial metabolism in diverse environments
mll02024  Quorum sensing
Module
mll_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    B1R94_22285
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B1R94_22285
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B1R94_22285
   00430 Taurine and hypotaurine metabolism
    B1R94_22285
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    B1R94_22285
Enzymes [BR:mll01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     B1R94_22285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AQT81394
UniProt: A0A1U9PK04
LinkDB All DBs
Position
complement(4685380..4686759)
Genome map
AA seq 459 aa AA seqDB search
MPHVKYRSPSIAPAYTGRLSTDPIPSLRLPDEAMEPAAAYRFIHDELMLDGSSRLNLATF
VTTWMDPEAEKLMAETFDKNMIDKDEYPATAAIESRCVAMVADLFHAENLRDDDASTAVG
VSTIGSSEAVMLGGLALKWRWKQRVGDQWKSRTPNLVMGSNVQVVWEKFCRYFEVEPRYI
PMAEDRYVITPEQVLDYVDEDTIGVVAILGTTYTGELEPIAEICAALDRLAQDRGLDVPV
HVDAASGGFVVPFLHPDLKWDFRLPRVASINVSGHKYGLTYPGIGFVVWRNADCLPEELI
FRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRSGYTHVMQCLSGTARWFSDQLENC
QHFEVISDGSAIPVVAFRLKGDLGYTEFDVSAALRSYGWQVPAYTMPEGAEDISVLRVVV
REGFSADLARSLWEDLNAVLGHLDAIKPEGHFTQEHFAH
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgccccacgtcaagtaccgttccccgtcgatcgcgccggcctataccgggcggctgtcc
accgacccgatcccgtcgctgcggctgccggacgaggcgatggaaccggctgcggcgtac
cggttcatccacgacgaactgatgctcgacggtagctcccggctcaacctcgcgacattc
gtcaccacctggatggaccccgaggccgagaagctgatggccgagacgttcgacaagaac
atgatcgacaaggacgagtacccggcgaccgcggccatcgaatcccgttgtgtggccatg
gtcgccgacctgttccacgccgagaacctgcgcgacgacgacgcgtccaccgcggtgggg
gtgtcgacgatcgggtcctcggaggcggtgatgctcggcgggctggcgctgaagtggcgg
tggaagcaacgggtcggcgaccagtggaagtcacggaccccgaacctggtgatgggctcc
aacgtccaggtggtgtgggaaaagttctgccgctatttcgaagtcgagccgcgctacatc
ccgatggccgaggaccgctatgtcatcacccccgaacaggtcctcgactacgtcgacgag
gacaccatcggcgtggtggccatcctcggcaccacctacaccggtgagctcgagccgatc
gccgaaatctgtgccgcactggaccggttggcgcaagacaggggactcgacgtgccggta
cacgtcgacgccgccagcggcggattcgtggtgccgttcctgcaccccgatctgaagtgg
gacttccggctgccgcgggtggcgtcgatcaacgtcagcggccacaagtacggcctgacc
tatccgggaatcggattcgtggtgtggcgcaacgcggactgtctgcccgaggaactgatc
ttccgggtcaactatctcggcggcgacatgccgaccttcacgctcaacttctcccgcccc
ggaaaccaggtggtcggccagtactacaacttcctgcgcctgggccgctccggctacacc
catgtgatgcaatgcctttcaggcactgcccggtggttctccgaccagctggagaactgc
cagcacttcgaggtgatctccgacggttcggcgatcccggtggtggcgttccggttgaag
ggcgacctcggctacaccgaattcgacgtctcggccgcgctgcgctcctacgggtggcag
gtgccggcctacaccatgcctgaaggcgccgaagacatttcggtgctacgcgtggtggta
cgtgagggcttctcggccgacctggcgcggtcgctgtgggaggacctcaacgcggtcctg
ggccacctggacgcgatcaagcccgagggccacttcacccaggaacacttcgcccactag

DBGET integrated database retrieval system