KEGG   Mycolicibacterium litorale: B1R94_26770Help
Entry
B1R94_26770       CDS       T05032                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mll  Mycolicibacterium litorale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AQT82077
UniProt: A0A1U9PMS5
LinkDB All DBs
Position
5591793..5592860
Genome map
AA seq 355 aa AA seqDB search
MNLPVMPPVSPMLAKSVSTIPPGASYEPKWDGFRSVCFRDGDEVVLGSRNEKPMTRYFPE
LVRAAVAELPQRCVIDGEIVIATDRGLDFEALQQRIHPADSRVRMLAEKTPAAFVAFDLL
ALGDDDYTGRPFEERRAALVSALSGSGPTFHVTPATTDLETAQRWFSEFEGAGLDGIVAK
PLRITYQPDKRVMFKIKHERTADCVVAGYRVHKSSDDAIGSLLLGLYTEDGTLASVGVIG
AFPMAQRRRLFAEFQSLVTDFEGHPWNWAAHEGGERTPQKNAGSRWNAGKDLSFVPLRPQ
RVVEVRYDHMEGERFRHTAQFNRWRPDRDPRSCTYEQLERPVTFSLGEIIPGFGV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgcccgtcatgccaccggtttcaccgatgctcgccaagtcggtatccaccatc
ccgcccggcgcctcctacgagccgaagtgggacgggttccgctcggtctgttttcgcgac
ggtgacgaggtggtgctgggcagccgcaacgagaaaccgatgacgcgctacttccccgaa
ctggttcgggccgccgtcgcggaactgccgcagcgctgcgtcatcgacggcgagatcgtc
atcgccaccgaccggggcctggacttcgaggcattgcaacagcggatccatccggccgac
tcccgggtgcggatgctcgccgagaagactccggccgccttcgtcgccttcgatctgctc
gccctcggcgacgacgactacaccggccggccgttcgaggagcgccgcgccgcgctggtg
tcggcattgtcgggcagtggtccgacgttccacgtcacaccggccaccaccgatctcgag
accgcacaacggtggttctccgagttcgaaggcgccgggctcgacggcatcgtcgccaaa
ccgctgaggatcacctatcagcccgacaagcgggtcatgttcaagatcaagcacgagcgc
accgccgactgcgtggtggccggctaccgggtgcacaagtcgagtgacgacgcgatcggc
tcgttgctgctcgggctctacaccgaggacggcaccctggcctcggtcggcgtcatcggc
gccttcccgatggcgcagcggcggcggctgttcgccgagttccagtccctggtaaccgat
ttcgaggggcacccgtggaactgggcggcccacgagggcggtgagcgcacaccacagaag
aatgcgggttcacgctggaacgccggtaaggacctctcgttcgtgccgctgcggccgcag
cgcgtggtcgaggtccgctacgaccacatggagggtgaacggttccggcacaccgcccaa
ttcaaccggtggcgcccggatcgcgatccgaggtcctgcacctacgaacagctcgagcgg
ccggtgacgttcagcctcggcgagatcattcccggtttcggcgtatag

DBGET integrated database retrieval system