KEGG   Mesorhizobium loti NZP2037: A9174_01650Help
Entry
A9174_01650       CDS       T04711                                 

Definition
(GenBank) iditol 2-dehydrogenase
Organism
mln  Mesorhizobium loti NZP2037
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ANN55604
LinkDB All DBs
Position
365490..366518
Genome map
AA seq 342 aa AA seqDB search
MKAVRLEAVGSIALREVGKPVASPDELLVRIEACGVCGTDRHLFHGEFPCRPPVTPGHEF
SGIIEAIGDTVSGFAVGDRVTGDPNIACGRCPQCHAGRVNLCRNLNAIGIHRDGGFAEYV
VLPQKQAFILPADLPPTHGAFCEPLGCCLHGVDLAQIRPGSSVIVLGGGVIGLLTVQLAK
LAGATTIILSTRQASRRALAEALGATATVDPTAGDVIDAIAGPAGLMPGGADVVFECAGV
RDTVEQSMRLARAGGTVVIVGVTPQGMKAEFEPFDLLFRELKVVGSFLNPYTHRRAAELI
ATGAIEVDRLISRQVPLDEAADVIANPPAPGEVKVLVVPRRG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggtgcggctggaggcggttggcagcattgcgctgcgcgaagtcggcaaacct
gtcgccagcccggacgagcttctggtgcggatcgaggcttgcggcgtctgcggcaccgac
cggcatcttttccatggcgaattcccctgccggccgccggtgacgcccggacatgaattt
tcgggcatcatcgaggcgatcggcgacaccgtctccggctttgccgtcggcgaccgcgtc
accggcgaccccaacatcgcctgcggacgatgcccgcaatgccatgccggccgggtcaat
ctctgccgcaatctcaacgccatcggcatccatcgcgatggcggctttgccgagtatgtc
gtgctgccgcagaaacaggctttcatcctgcccgccgatctgccgccgacgcatggcgcc
ttctgcgagccgctcggctgctgcctgcatggcgtcgaccttgcgcagatcaggccgggc
agctcggtgatcgtgctgggcggcggcgtgatcggcctgctgaccgtgcaattggcaaaa
ctggccggcgccacgaccatcatcctgtcgaccaggcaggcttctcggcgcgcgcttgcc
gaggcgctcggcgcgacggcgacggtcgatcccaccgccggcgacgtcatcgatgccatc
gcaggccccgcgggcctgatgccgggcggcgccgacgtggtgttcgaatgcgctggcgtg
cgcgacaccgtcgagcaatcgatgcgactggcaagggccggcggcacggtcgtcattgtc
ggcgtgacaccgcaaggcatgaaggcggaattcgaaccttttgacttgctgtttcgggag
ttgaaggtggtcggctcattcctcaatccctacacgcatcgccgcgccgccgagctcatc
gcgacgggcgcgatcgaggtcgaccggctgatctccaggcaggtgccgctcgacgaggcg
gccgatgtgatcgccaacccgccggcgcccggcgaggtcaaggttctggtggtgccgcga
cggggttga

DBGET integrated database retrieval system