KEGG   Mesorhizobium loti NZP2037: A9174_01650
Entry
A9174_01650       CDS       T04711                                 

Definition
(GenBank) iditol 2-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
mln  Mesorhizobium loti NZP2037
Pathway
mln00040  Pentose and glucuronate interconversions
mln00051  Fructose and mannose metabolism
mln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A9174_01650
   00051 Fructose and mannose metabolism
    A9174_01650
Enzymes [BR:mln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     A9174_01650
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Other DBs
NCBI-ProteinID: ANN55604
LinkDB
Position
365490..366518
AA seq 342 aa
MKAVRLEAVGSIALREVGKPVASPDELLVRIEACGVCGTDRHLFHGEFPCRPPVTPGHEF
SGIIEAIGDTVSGFAVGDRVTGDPNIACGRCPQCHAGRVNLCRNLNAIGIHRDGGFAEYV
VLPQKQAFILPADLPPTHGAFCEPLGCCLHGVDLAQIRPGSSVIVLGGGVIGLLTVQLAK
LAGATTIILSTRQASRRALAEALGATATVDPTAGDVIDAIAGPAGLMPGGADVVFECAGV
RDTVEQSMRLARAGGTVVIVGVTPQGMKAEFEPFDLLFRELKVVGSFLNPYTHRRAAELI
ATGAIEVDRLISRQVPLDEAADVIANPPAPGEVKVLVVPRRG
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgaaagcggtgcggctggaggcggttggcagcattgcgctgcgcgaagtcggcaaacct
gtcgccagcccggacgagcttctggtgcggatcgaggcttgcggcgtctgcggcaccgac
cggcatcttttccatggcgaattcccctgccggccgccggtgacgcccggacatgaattt
tcgggcatcatcgaggcgatcggcgacaccgtctccggctttgccgtcggcgaccgcgtc
accggcgaccccaacatcgcctgcggacgatgcccgcaatgccatgccggccgggtcaat
ctctgccgcaatctcaacgccatcggcatccatcgcgatggcggctttgccgagtatgtc
gtgctgccgcagaaacaggctttcatcctgcccgccgatctgccgccgacgcatggcgcc
ttctgcgagccgctcggctgctgcctgcatggcgtcgaccttgcgcagatcaggccgggc
agctcggtgatcgtgctgggcggcggcgtgatcggcctgctgaccgtgcaattggcaaaa
ctggccggcgccacgaccatcatcctgtcgaccaggcaggcttctcggcgcgcgcttgcc
gaggcgctcggcgcgacggcgacggtcgatcccaccgccggcgacgtcatcgatgccatc
gcaggccccgcgggcctgatgccgggcggcgccgacgtggtgttcgaatgcgctggcgtg
cgcgacaccgtcgagcaatcgatgcgactggcaagggccggcggcacggtcgtcattgtc
ggcgtgacaccgcaaggcatgaaggcggaattcgaaccttttgacttgctgtttcgggag
ttgaaggtggtcggctcattcctcaatccctacacgcatcgccgcgccgccgagctcatc
gcgacgggcgcgatcgaggtcgaccggctgatctccaggcaggtgccgctcgacgaggcg
gccgatgtgatcgccaacccgccggcgcccggcgaggtcaaggttctggtggtgccgcga
cggggttga

DBGET integrated database retrieval system