KEGG   Mesorhizobium loti NZP2037: A9174_05180Help
Entry
A9174_05180       CDS       T04711                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mln  Mesorhizobium loti NZP2037
Pathway
mln00020  Citrate cycle (TCA cycle)
mln00190  Oxidative phosphorylation
mln00650  Butanoate metabolism
mln01100  Metabolic pathways
mln01110  Biosynthesis of secondary metabolites
mln01120  Microbial metabolism in diverse environments
mln01130  Biosynthesis of antibiotics
mln01200  Carbon metabolism
Module
mln_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mln_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mln_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A9174_05180
   00650 Butanoate metabolism
    A9174_05180
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A9174_05180
Enzymes [BR:mln01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A9174_05180
    1.3.5.4  fumarate reductase (quinol)
     A9174_05180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_7 Fer2 Fer4_9
Motif
Other DBs
NCBI-ProteinID: ANN56226
LinkDB All DBs
Position
1082901..1083680
Genome map
AA seq 259 aa AA seqDB search
MVELTLPKNSKIQQGKTWPKPEGATNLREYRIYRWSPDDDENPRIDTYFVDMDDCGPMVL
DALLWIKNKIDPTLTLRRSCREGICGSCAMNIDGSNTLACTKGCDDISGAVKVYPLPHMQ
VVKDLVPDLTNFYAQHASIEPWLKTVSPQPAKEWLQSHEDREKLDGLYECILCACCSTSC
PSYWWNGDRYLGPATLLQAYRWLIDSRDEAKGERLDNLEDPFRLYRCHTIMNCAQTCPKG
LNPAKAIAEIKKMMVERRV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaactgacgctccccaagaattcgaagatccagcagggcaagacctggccgaag
ccggagggtgccaccaatctgcgggaataccgcatctaccgctggtcgccagacgatgac
gagaacccgcgcatcgacacctatttcgtcgacatggacgattgcgggccgatggtgctc
gacgcgctgctctggatcaagaacaagatcgacccgacgctgaccttgcgccgctcctgc
cgcgaaggcatttgcggctcctgcgccatgaacatcgacggctccaacacgctggcctgt
accaagggctgcgacgacatttccggcgccgtcaaagtctatccgctgccgcatatgcag
gtggtgaaggatctggtgcccgacctcaccaatttctacgcccagcacgcctcgatcgag
ccgtggctgaagacggtgtcgccgcagccggccaaggaatggctgcagagccatgaggac
cgcgagaagctcgacgggctctacgaatgcatattgtgcgcctgttgctcgacctcgtgc
ccgagctattggtggaacggcgatcgctatctcggcccggcaaccctcttgcaggcctat
cgctggctgatcgacagccgcgacgaggccaagggcgagcggctcgacaatctcgaggac
ccgttccggctctatcgctgccacaccatcatgaactgcgcgcagacctgccccaagggc
ctcaacccggccaaggcgatcgccgagatcaagaagatgatggtggagcgccgagtctga

DBGET integrated database retrieval system