KEGG   Mesorhizobium loti NZP2037: A9174_05400Help
Entry
A9174_05400       CDS       T04711                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
mln  Mesorhizobium loti NZP2037
Pathway
mln00500  Starch and sucrose metabolism
mln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A9174_05400
Enzymes [BR:mln01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     A9174_05400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ANN56266
LinkDB All DBs
Position
complement(1121182..1123593)
Genome map
AA seq 803 aa AA seqDB search
MAVTPIVPPGAPGIPARWTSSAKSGVGTAFSAKSPLWFTISHGILNEIYYPRLDSACTRD
MELIVTGPGGYFSEEKRDAAHAVAPFEDGVPGYRLTNTAADGAYRIEKRIITDPKRPVLL
QEIAFVPLKNSAADYKIYALLAPHLVNAGMGNTAWVGEHKGQRMLFATGRGVSLALVSSL
PWNTCSAGYVGFSDGWQQLQNGGALDPSCQRAEDGNVALTGEIGFSAGKTTALLALGFGA
TPEAAADVALASLKQGFDAAAETYVENWRTFQTRLEKLDRHTASGLNTYRVSTAVLASHL
SVARPGAAVASLSIPWGFNKGDDDLGGYHLVWPRDLVETAGGFLAAGDGKQALQILTYLH
SIQQPDGHWPQNVWSDGTAYWPGIQMDECAFPLLLADALRRAGHLPRARLADFLAMIEAA
ASYVVRNGPVTGEDRWEEDAGYSPFTLAVEIAALLAAADMLDILGKSEPANYLRETADCW
NDQVERWTYVTGTQLCIEAGITGYYVRIAPPDDAGAASPKDGFVPIKNRPPADTDKPAEA
IISPDALALVRFGLRAADDPRIVGTVKAVDTLLRCDLPQGPVWYRYTDDGYGEHEDGTPF
DGTGRGRAWPLLTGERAHYELAAGRKEKAAQLLETFERSAGMGGLLPEQVWDSPDVPGRE
LWEGKPSGSAMPLVWAHAEHIKLLRSLRDGVVFDTPPQGVERYIKGKTSSPLRIWRFNNK
IRSIPAGKALRVELSAPGVVHWSSDNWLTIQDHKTRETAFGVHLADLPVAGLTSGSTIVF
TFFWPDAMRWENVDFSVGIDASW
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgacgccgatcgttcccccgggcgcaccgggcattccggcgcgctggacgtcg
agcgccaagagcggcgtcggcaccgcgttttcagccaagagcccgctctggttcaccatc
agccacggcatcttgaacgagatctactatccgcgtctcgacagcgcctgcacgcgcgac
atggagctgatcgtcaccggccccggtggctatttctcggaagagaagcgcgacgccgcg
cacgcagtagcgcctttcgaggacggcgtacccggctacaggctgaccaacaccgcggca
gacggcgcctaccgtatcgaaaagcgcatcattacggatccgaaacggcctgtcctgctg
caggagattgcattcgtaccgctgaaaaattcggcggccgactacaagatctacgcgctg
cttgcgccgcacctcgtcaacgccggcatgggcaacactgcctgggtcggcgaacacaag
ggccagcgcatgctcttcgccacggggcgcggcgtatcccttgcgctcgtctcctcactg
ccctggaatacctgttcggccggctatgtcggtttctccgacggatggcagcaattgcag
aacggcggtgcgctcgatccctcctgccagcgggcggaagacggcaatgtcgctctgacc
ggcgagatcggcttttctgccggcaagaccacggccttgctggcgcttggcttcggcgcg
acgccggaagccgccgccgacgtggcgctggccagtctcaagcagggtttcgacgccgcc
gccgaaacctatgtcgaaaactggcggacatttcagaccaggcttgagaagctcgaccgc
cacactgcctccgggctgaacacctatcgtgtgagcacagcggttctggcctcgcatctc
tcggtcgcgagacccggcgccgctgttgccagcctgtcgatcccatggggcttcaacaag
ggcgacgacgatctcggcggctaccatctggtctggccgcgcgacctggtcgagaccgct
ggcggtttcctcgccgccggcgacggcaagcaggcgctgcagatcctgacctatctgcac
tcgattcagcaaccggacggtcactggccgcagaatgtctggtcggacggcaccgcctat
tggcccggcatccagatggatgaatgcgcctttccgctgctgctggccgacgccttgcgc
cgggcgggccacctgccgcgtgccaggctcgccgatttcctggccatgatcgaagccgcc
gcctcctatgtcgtgcgcaacggccccgtcaccggcgaggaccgctgggaggaagacgcc
gggtacagcccgttcacgctggccgtcgagatcgccgcgctgcttgccgccgccgatatg
ctggatatcctgggaaagagtgagccggcaaactacctgcgcgaaaccgctgattgctgg
aacgatcaggtcgaacgctggacctacgtcacgggcacccagctctgcatcgaggccggc
atcacaggctactatgtccgcatcgcgccgccggacgatgcgggcgccgcatcgccgaag
gacggcttcgtgccgatcaagaaccgtccgccggccgacactgacaaaccggcagaagcc
ataatcagccccgacgccctggccctggttcgctttggcctcagggcagccgacgatccg
cgcatcgtcggtaccgtcaaggccgtcgacacccttttgcgatgcgatctgccgcaaggc
ccggtctggtaccgctacaccgatgacggctatggcgagcacgaggatggcacgcctttc
gacggcacaggccggggacgcgcctggcccctgctcaccggcgagcgggcgcattacgag
cttgccgccggccgtaaggagaaagccgcgcagcttctggagaccttcgagcgttcggct
ggcatgggcgggctgctgccggaacaggtctgggacagcccggatgtgccgggccgcgag
ctgtgggagggcaaaccgtccggcagcgccatgccactggtctgggcgcatgccgagcac
ataaagctgttgcgttcgttgcgcgacggcgtggtcttcgacacgccgccgcaaggcgtc
gagcgctacatcaagggcaagacaagctcgccgctcaggatatggcgcttcaacaacaaa
atccgctccatcccggccggcaaggctttacgcgtagagctttcggcgcccggcgtcgtc
cattggagcagcgacaactggctgacgatccaggaccacaagaccagggaaaccgctttt
ggcgtccatctggccgacctgccggtcgccggattgacgtcgggaagcaccatcgtcttc
acttttttctggcccgatgcgatgcgttgggagaatgtcgacttcagcgtcggcatcgac
gcatcgtggtaa

DBGET integrated database retrieval system