KEGG   Mesorhizobium loti NZP2037: A9174_07750Help
Entry
A9174_07750       CDS       T04711                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
mln  Mesorhizobium loti NZP2037
Pathway
mln00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mln01100  Metabolic pathways
mln01110  Biosynthesis of secondary metabolites
mln01130  Biosynthesis of antibiotics
mln01230  Biosynthesis of amino acids
Module
mln_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mln00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A9174_07750
Enzymes [BR:mln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     A9174_07750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 Cytidylate_kin2 AAA_18 TsaE AAA Mg_chelatase AAA_16
Motif
Other DBs
NCBI-ProteinID: ANN61305
LinkDB All DBs
Position
1591498..1592109
Genome map
AA seq 203 aa AA seqDB search
MNAHQANPPGESLAALLGRLGSRSIVFVGLMGAGKTAIGRKVATMLSLPFIDSDQEIESV
SRMTVPELFERYGETEFRALEQRVILRVLENGPQVLSTGGGAFMNAQTREAIAAHGVSVW
LKAELDLLMDRVSKKQNRPLLKSADPRAVLERLMGERYPVYATSDVTVPTRDDRKEVIAA
EVLDALCRHFGIDEIAATGEIES
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgcaccaggcaaatcctccaggcgagagcctcgccgcgctgcttggccggctg
ggcagccggtccatcgtgtttgtcggcctgatgggcgccggcaagacggcgatcggccgc
aaggtggcgacgatgctttcgctgcccttcatcgacagcgaccaggagatcgaaagcgtc
tcgcgcatgaccgtgccggagctgttcgagcgctatggggagaccgagttcagggccctg
gagcagcgtgtcatcctgcgcgtgcttgaaaatggcccgcaggtgctttcgaccggcggc
ggcgccttcatgaacgcgcagacgcgcgaagccatcgccgcgcatggcgtctcggtgtgg
ctaaaggcggaactcgatcttctgatggaccgggtttcgaagaagcagaaccggccgctg
ttgaaaagcgccgatccccgcgccgtgctggagcggctgatgggcgagcgctatccggtc
tacgcgacatcagatgtcaccgtgccgacccgcgacgaccgcaaggaggttatcgccgcc
gaggtgctggacgcgctgtgccggcatttcggcatcgatgaaattgcagcgacgggcgag
atcgaatcatga

DBGET integrated database retrieval system