KEGG   Mesorhizobium loti NZP2037: A9174_08110Help
Entry
A9174_08110       CDS       T04711                                 

Definition
(GenBank) ribonuclease BN
  KO
K07058  membrane protein
Organism
mln  Mesorhizobium loti NZP2037
Brite
KEGG Orthology (KO) [BR:mln00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    A9174_08110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB Reticulon DUF5083
Motif
Other DBs
NCBI-ProteinID: ANN56746
LinkDB All DBs
Position
1659714..1660565
Genome map
AA seq 283 aa AA seqDB search
MLRNIVALRRVLYDALGHFNTDDGWAMASHLAITSLMALFPFLIFATTLGSFLGAQAFAD
TAVHLVFDTWPDQIAKPIAHEVLNVLTVRRTDLLTYGVLLAAYFASNGIEALRTSLNRAY
RVTETRGIIYRRVQSIFFVLIATAGFLAISVLLVFAPLLARLAEAHFEWIKPYTGTITLW
RYVIASAVIIGGLFAVHYWLPAGKRRFVSLVPGIVFTLAAWLIGSTMFATYLDHFSSYVT
TYAGLASIMIAVVFLYIVSAIFILGGELNAAISRYLEARARVG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgttgcggaatattgtcgccctgcgccgcgtgctctacgacgcgctcggccatttcaac
accgatgacggctgggcgatggccagccatctggcgatcacctcgctgatggcgctgttt
cctttcctgatcttcgccacgacgctgggcagcttcctcggcgcccaggcctttgccgac
acggccgtgcacctggtcttcgacacctggccggatcagatcgccaagccgatcgcgcat
gaggtgctgaacgtgctgaccgtccggcgcaccgacctgttgacctatggcgtgctgctt
gccgcctatttcgcgtcgaacggcatagaggcgctacgcacctcgctcaaccgcgcctat
cgtgtcaccgagacgcgcggcatcatctaccgccgggtgcagagcatcttcttcgtgctg
atcgcgacggccggcttcctggcgatcagcgtgcttctggtgttcgcacccctgctggcg
cggctggcggaagcgcatttcgaatggataaagccctataccggcacgatcacgctgtgg
cgctacgtcatcgcctcggccgtcatcatcggcgggttgtttgccgtgcactactggctg
ccggccggcaagcgccgcttcgtctcgctggtgccgggcatcgtcttcacactggccgca
tggctcatcggctcgacgatgttcgccacatatctcgaccatttctcgtcctatgttacg
acttacgccgggttggcctcgatcatgatcgcggtggtcttcctctacatcgtctcggcg
atcttcatcctcggcggcgagctcaacgccgcgatcagccgctatctcgaggcgcgtgcc
cgggtcggatga

DBGET integrated database retrieval system