KEGG   Mesorhizobium loti NZP2037: A9174_13805Help
Entry
A9174_13805       CDS       T04711                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mln  Mesorhizobium loti NZP2037
Pathway
mln00010  Glycolysis / Gluconeogenesis
mln00620  Pyruvate metabolism
mln01100  Metabolic pathways
mln01110  Biosynthesis of secondary metabolites
mln01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9174_13805
   00620 Pyruvate metabolism
    A9174_13805
Enzymes [BR:mln01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     A9174_13805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ANN57725
LinkDB All DBs
Position
complement(2870175..2871692)
Genome map
AA seq 505 aa AA seqDB search
MNKVEFSRPVKAPFDKRYGNFIGGKWTEPRSGRYFDNHSPVNGQLLCEVARSDAQDIEAA
LDAAHAAKDAWGRTSVAERSLILNRIADRMEENLDLLACAETWDNGKPIRETTAADLPLA
IDHFRYFAGAVRGQEGSLSQIDDDTVAYHFHEPLGVVGQIIPWNFPLLMACWKLAPALAA
GNCVVLKPAEQTPAAILLWADLIGDLLPPGVLNIVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVVAEDDDFFDKAIEGFVMFALNQGEVC
TCPSRALIHESIYDRFMERALKRVEAIVQGDPLDPATMIGAQASSEQLEKILSYIDIGRQ
EGAEVLTGGARNVLPGDLAGGYYVKPTVFRGHNKMRIFQEEIFGPVVSVTTFKDDDEALS
IANDTLYGLGAGVWTRDGNRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETH
KMMLDHYQQTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggttgaattctcacgcccggtcaaggcgcctttcgacaagcgttacggcaat
ttcatcggcggcaaatggaccgagcctcgctccggccgctacttcgataaccactccccg
gtgaacggccagctgctgtgcgaggtggcgcgctcggatgcccaggacatcgaggcggcc
ctggatgcggcccatgccgccaaggacgcgtggggacgcaccagcgtggccgagcggtcg
cttatcctcaaccgcatcgccgaccgcatggaggagaatctcgatctcctcgcctgcgcc
gaaacctgggacaacggcaaaccgatccgggaaacgaccgcggccgatctgcctctggcc
atcgaccatttccgctatttcgccggcgccgtgcgcggccaggaaggcagcctttcgcag
atcgacgacgacactgtcgcctaccatttccacgagccgctcggcgtggtcggccagatc
attccctggaacttcccgctgctgatggcatgctggaagcttgcgcccgcgcttgcggcc
ggcaactgcgtggtgctgaagcccgccgagcagacaccggccgccatcctgctttgggcc
gatcttatcggcgatctgctgccgccaggcgtgctcaacatcgtcaacggcttcggcctc
gaggccggcaagccactcgcgtcgtcgccgcgcatcgccaagatcgcctttaccggcgag
accacgacgggccggctgatcatgcagtatgccagccagaaccttatccccgtcacactg
gaactgggcggcaagtcgcccaacatcttcttcaaggacgttgtcgccgaggacgacgat
ttcttcgacaaggccatcgaaggcttcgtcatgttcgcgctgaaccagggtgaggtctgc
acctgcccgagccgtgcgctcatccatgaatcgatctacgacaggtttatggaacgtgcc
ctcaagcgcgtcgaagcgatcgtgcagggcgatccgctcgacccggcgacgatgattggc
gcccaggcctcgtccgagcagctggaaaagatcctgtcctacatcgacatcggccgccag
gaaggcgccgaggtgctgaccggcggtgctcgcaatgttctgcctggcgacctggcgggc
ggctattacgtcaagccgaccgtgttcaggggccacaacaagatgcgcatcttccaggaa
gagattttcggaccggtggtttcggtcacgaccttcaaggacgacgacgaagcgctcagc
attgccaacgacacgctctacgggctcggcgccggcgtctggacccgtgacggcaaccgc
gcctatcgcttcggccgcgcgatccaggccggccgcgtctggaccaactgctaccacgcc
tatcccgcgcatgcggccttcggcggttacaagcagtccggcatcggccgcgagacgcac
aagatgatgctcgaccattatcagcagaccaagaacatgctggtcagctatagcccgaag
aagctcggcttcttctga

DBGET integrated database retrieval system