KEGG   Mesorhizobium loti NZP2037: A9174_15345
Entry
A9174_15345       CDS       T04711                                 

Definition
(GenBank) type VI secretion protein
  KO
K11902  type VI secretion system protein ImpA
Organism
mln  Mesorhizobium loti NZP2037
Brite
KEGG Orthology (KO) [BR:mln00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mln02044]
    A9174_15345
Secretion system [BR:mln02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A9174_15345
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: ANN57986
LinkDB
Position
complement(3207603..3208778)
AA seq 391 aa
MIDLALWLNPLDGANPSGEDLRNDPAFHELERLTEAQLKVVHDGGNKASQSTSAVDWAAV
LEKSEELQSRGRDLRLLVIVTRALANEEKLAGLAQGLTLIARTLDQYWDTMHPALRTGAT
PRDAALRRINALLDLQNGQEGLLANLRQTVFFSPRAIGPISGRDLEQAALDERVMLQEAA
SGLGTAEKAALAAAHNQLLNRVRTACAAQIDQAADTVTTLLADARAAISALEAVDTALNA
RIEGNGAAVPDLKKFLQRLLTTLERNSSAGAMANGAAKPAQQPAQPASTPTQNGHGAETM
ASVASSVEPSAGLPDRINSRDDVVKCLDLVVAFYDRTEPSSPIPHLARRVRRMVHMDFVE
LMEDLAPSGLKEFRLLAGVADPKKPAQKDER
NT seq 1176 nt   +upstreamnt  +downstreamnt
gtgattgatctcgcactctggctgaatcctctggacggcgcgaacccgtcgggagaggac
ttacgcaacgacccggcttttcatgagctggagcggctcacggaagcccagctcaaggtc
gtccacgacggtggcaacaaggcttcgcagtcaaccagcgctgtcgactgggcggcagtc
ctcgaaaaatcggaagaattgcagtcgcgcggccgggatttgcgccttctggtcatcgtc
acgcgcgcgctggccaatgaagagaagctcgccggcctcgcccaagggctgaccctgatc
gcgaggactctcgaccagtactgggatacgatgcatccggccttgcggacgggtgccacg
ccgcgcgacgcggcgctgcgacgcatcaatgcgctgcttgacctccagaacggccaggaa
ggcctgctggcgaacctcaggcagaccgtcttcttctcaccgcgcgccatcgggccgatc
agcgggcgagacctggaacaggcagcgctcgacgagcgcgtcatgctccaggaagctgcc
tcgggcctcggaaccgccgaaaaggcggcgctggcggccgcccacaaccagctgctgaac
cgggtgcgcacagcatgcgcggcgcagatcgatcaggccgccgacactgtcacgacactt
ttggccgatgcgcgcgccgcgatttcggcgctggaggcggtggataccgcgctcaatgcc
cgcatcgagggcaatggcgcggccgttccggatctgaagaagttcctgcagcgcctgctg
acgacgctggagcggaactccagcgccggcgccatggccaacggtgcggcaaagcctgcc
cagcagccggcccaaccggcatcgacgcccacccaaaacggtcatggagccgagacgatg
gcaagtgtggcaagctctgtggaacccagcgccggcctgcctgaccggatcaactcgcgc
gacgatgtcgtcaaatgcctcgatctcgtggtcgccttctacgaccgcactgaaccgtcc
agccctatcccgcacctcgcccggcgcgtgcgcaggatggtgcacatggatttcgtggaa
ctgatggaggatctcgccccgtcggggctgaaggaattccggctgcttgccggtgtcgcc
gatcccaagaagccggcccagaaggatgaaaggtaa

DBGET integrated database retrieval system