KEGG   Mesorhizobium loti NZP2037: A9174_17440Help
Entry
A9174_17440       CDS       T04711                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mln  Mesorhizobium loti NZP2037
Pathway
mln00473  D-Alanine metabolism
mln00550  Peptidoglycan biosynthesis
mln01100  Metabolic pathways
mln01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mln00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A9174_17440
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A9174_17440
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    A9174_17440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mln01011]
    A9174_17440
Enzymes [BR:mln01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A9174_17440
Peptidoglycan biosynthesis and degradation proteins [BR:mln01011]
 Precursor biosynthesis
  Amino acid ligase
   A9174_17440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 RimK
Motif
Other DBs
NCBI-ProteinID: ANN58352
LinkDB All DBs
Position
3623822..3624895
Genome map
AA seq 357 aa AA seqDB search
MTEKTRVAILYGGRSAEHDVSRLSAANVLKAIDRTRYQVVPIAISRDGRWRLQPSSEAGA
DGAGASVSEDGVEVALLPGGKGRLVALTESGEQPDPVDVVFPVLHGPFGEDGSVQGYAEV
ADVAYVGCGVLASAAAMDKDVAKRLLREAGLAVARSVTVLRGEVGPFQEIAGALGLPFFA
KPARQGSSFGVSKVHDRDGFEQAVETALRYDSKALIEEFVDGREIECSVLERADGSLTVS
PPGEIIPADKHGFYTYEAKYFDADGALVKVPADVPADVVARTSEMAARAFRALGCEAMAR
VDFFLRADGSLLVNEVNTLPGFTDISMYAKALAAIGIGYSQVIDVLIEHALARHAAR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaagaccagggtcgccatcctctatggcgggcgctcggccgagcatgacgtg
tcgcggctgtcggcggccaatgtgctgaaggcgatcgaccggacgcgctaccaggtggtg
ccgatcgccatttccagggatggcagatggcggctgcagccttcgtccgaggccggcgcc
gacggggcaggggcttcggtgtctgaggatggcgtggaggtagccctgctgccaggcggc
aagggccggctggtggctctcaccgagagcggcgaacagcctgaccctgtcgatgtcgtc
tttcccgtgctgcatgggccgttcggcgaggacggttcggtgcaaggctatgccgaggtt
gccgatgtcgcctatgtcggctgcggcgtcctggcttccgccgccgccatggacaaggat
gtcgccaagcggctgctacgcgaggcagggcttgccgttgcccgctcggtcaccgtgctg
agaggcgaggtcggtccgttccaggagattgccggggcgcttgggctgcccttcttcgcc
aagccggcgcgccagggctcgtccttcggggtgagcaaggtgcatgacagggatggcttc
gaacaggccgtcgaaacggctttgcgctatgacagcaaggcgctgatcgaggagttcgtc
gacggccgcgagatcgagtgttcggtgctggagcgggccgacggttcgctgacggtttcg
ccgcccggcgagatcattccggccgacaagcatgggttctacacctatgaagcgaagtat
ttcgacgccgacggcgcgctggtcaaggtgcccgccgatgtcccggcggatgtcgttgcc
aggacgagcgagatggccgcgcgggctttccgggcgctcggctgcgaggccatggcgcgc
gtcgacttcttcctgcgcgccgacggttcgctgctggtcaacgaggttaacacgctgccc
ggcttcaccgacatctcgatgtacgccaaggcgctggcggcgatcggcatcggctacagc
caggtgatcgacgtgctgatcgagcacgcgctggccaggcatgcggcgcgctga

DBGET integrated database retrieval system