KEGG   Mesorhizobium loti NZP2037: A9174_22125Help
Entry
A9174_22125       CDS       T04711                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mln  Mesorhizobium loti NZP2037
Pathway
mln00564  Glycerophospholipid metabolism
mln01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mln00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A9174_22125
Enzymes [BR:mln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A9174_22125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 NAD_binding_8 STPPase_N Mqo
Motif
Other DBs
NCBI-ProteinID: ANN59166
LinkDB All DBs
Position
4610299..4611825
Genome map
AA seq 508 aa AA seqDB search
MDTSSVRDIFVIGGGINGCGIARDAVGRGFSVFLAEMNDLASGTSSGSTKLIHGGLRYLE
FYEFRLVREALMEREVLWKNAPHIIWPMRFVLPYAKGLRPAWLIRLGLFLYDHIGGRKLL
PATRTLDMASDPAGKPLKPLFKKAFEYSDGWVNDARLVALNARDAADRGATIRTRTKVVG
ARRENGLWTIKIENLQSGETEEIKARLLVNAAGPWVDHVLSGVVGLNDVHNVRLVQGSHI
VIAKKFDDPRAYFFQNKDGRIIFAIPYEDEFTLIGTTDRDYPGDPHDVKISDTEIDYLCA
AASEYFAQPVKRSDIVWTYSAVRPLYDDGASKAQEATRDYVLKADGGEGAAPIVNAFGGK
ITTYRRLSESMLEKIEGFLGKRGKPWTSDAPLPGGDFPATGFDAQVAKLKTAYPFLDARL
ARRLTRLYGTRAQRLLGLAKSNAELGRNFGGDLYEAEVRYLVENEWAVTSEDVLWRRTKR
GLHLNREQVAALDEFMRGISRRHVAAAE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtggacacgtcttcagtccgggatattttcgtcataggtggcggtatcaacggttgcggc
atagcccgcgatgccgttgggcgcgggttttcggtttttctcgccgagatgaacgacctc
gccagcggaacctcctccggttccaccaagctgatccatggcggcctgcgctatctcgaa
ttctacgagttccgcctggtgcgcgaggcgctgatggagcgcgaggttctgtggaagaac
gcgccgcacatcatctggccgatgcgctttgtgctgccctatgccaaggggctgcgcccg
gcctggctgatcaggctcggcctgttcctgtacgaccacattggcgggcgcaaattgctg
ccggcgaccaggacgctcgacatggcgagcgatccggcgggcaagcctttgaagccgttg
ttcaaaaaggcgttcgaatattccgacggctgggtcaacgatgcgcggctggtggcgctc
aacgcacgcgatgccgctgatcgcggtgcaacgatccggacccgcacgaaggtggtcggc
gcgcgtcgcgaaaacggcctttggacaatcaagatcgagaacctgcagagcggcgagacg
gaagagatcaaggcgcggctgctggtcaatgccgccggaccgtgggtcgatcatgtgctt
tccggtgtcgtcggcctcaacgatgtgcacaatgtccgcctggtgcagggcagccatatc
gtcatcgccaagaagttcgacgatccgcgcgcctatttcttccagaacaaggatggccgc
atcattttcgccattccctacgaggacgagttcacgctgatcggcaccaccgaccgggat
tatcccggcgatccgcacgatgtgaagatcagcgacaccgagatcgattatctctgcgcc
gcggccagcgagtatttcgcgcaacccgtcaagcgctccgacatcgtctggacctattcg
gccgtgcgcccgctctatgacgacggcgcctccaaggcgcaggaagcgacgcgcgactat
gtgctgaaggccgatggcggcgagggtgcagctccgatcgtcaatgcgttcggcggcaag
atcaccacctaccgccggctgtcggaatcgatgctggagaagatcgaaggttttctcggc
aagcgcggcaagccgtggacatcggacgcgccgttgccgggcggcgacttcccggcgacc
gggttcgacgcgcaagtggcgaagcttaagacagcctatcctttcctcgatgcgcgtctc
gcccgccgactgacccggctttacgggacgcgggctcagcgtctgcttggtcttgccaag
tcgaatgccgagctcggccgcaatttcggcggcgatctctatgaggccgaagtgcgctat
ctcgttgaaaatgaatgggccgtcacatcagaggatgtactgtggcgccgcaccaagcgc
ggcctgcatctcaaccgcgagcaggtggcggcactcgatgaattcatgcgcggcataagc
cggcggcatgtcgcggccgccgaatga

DBGET integrated database retrieval system