KEGG   Mesorhizobium loti NZP2037: A9174_23645Help
Entry
A9174_23645       CDS       T04711                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
mln  Mesorhizobium loti NZP2037
Brite
KEGG Orthology (KO) [BR:mln00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mln03012]
    A9174_23645
   03029 Mitochondrial biogenesis [BR:mln03029]
    A9174_23645
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mln04147]
    A9174_23645
Translation factors [BR:mln03012]
 Eukaryotic Type
  Elongation factors
   A9174_23645
 Prokaryotic Type
   A9174_23645
Mitochondrial biogenesis [BR:mln03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    A9174_23645
Exosome [BR:mln04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   A9174_23645
  Exosomal proteins of breast cancer cells
   A9174_23645
  Exosomal proteins of colorectal cancer cells
   A9174_23645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: ANN59425
LinkDB All DBs
Position
complement(4912312..4913487)
Genome map
AA seq 391 aa AA seqDB search
MAKGKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGEYKRYDQIDAAPEEKARGITIST
AHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPSIVVFLNKVDQVDDVELLELVELEVRELLSKNEFPGDDIPIVKGSALAALEDSNKT
IGEDAIRELMAQVDAYIPTPVRPLDKPFLMPIEDVFSISGRGTVVTGRVERGVVKVGEEL
EIIGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDREGVERGQVLAKPGTVKPHK
KFVAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGIVSLPAGTEMVMPGDNITVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVVTIKE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaaattcgagcgcactaagcctcatgtgaacatcggcacgattggtcac
gttgaccatggcaagacgtcgctgacggcggcgatcacgaagtattttggcgagtacaag
cgctacgaccagatcgatgcggcgccggaagagaaggcacgcggcatcaccatctcgacg
gctcacgttgaatacgagacggccaaccgccactacgctcacgtcgactgccccggccac
gccgactatgtgaagaacatgatcaccggtgccgcgcagatggacggcgcgatcctggtc
gtgtcggccgccgacggcccgatgccgcagacccgcgagcacatcctgcttgcccgtcag
gtcggcgtgccgtcgatcgtggtgttcctgaacaaggtcgaccaggtcgacgacgtcgag
ctgctcgaactggtcgagctcgaggttcgtgaactgctgtcgaagaacgagttccccggc
gacgacattccgatcgtcaagggttcggcgctggccgcgcttgaggattccaacaagacg
atcggcgaggacgcgatccgcgagctgatggctcaggtcgacgcctacatcccgacgcct
gttcgtccgctcgacaagccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgcggcacggtcgtgaccggccgcgtcgagcgcggcgtggtcaaggtcggcgaggagctg
gaaatcatcggcatccgtccgacgaccaagacgacctgcacgggcgtggaaatgttccgc
aagctgctcgatcagggccaggctggcgacaacatcggcgcgctgctgcgcggcgttgat
cgtgaaggtgtcgagcgcggccaggttctggccaagcccggcacggtgaagccgcacaag
aagttcgtggccgaggcctacatcctgaccaaggacgaaggtggccgtcacacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgacggacgtgaccggcatcgtgtcg
ctgccggctggcaccgagatggtcatgcctggcgacaacatcacggtcgatgtcgagctg
atcgtgccgatcgccatggaagagaagctgcgcttcgccatccgtgaaggcggccgcacc
gtcggtgccggcatcgtcgtcaccatcaaagagtaa

DBGET integrated database retrieval system