KEGG   Mesorhizobium loti NZP2037: A9174_32585Help
Entry
A9174_32585       CDS       T04711                                 

Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
mln  Mesorhizobium loti NZP2037
Pathway
mln00440  Phosphonate and phosphinate metabolism
mln01100  Metabolic pathways
mln01120  Microbial metabolism in diverse environments
mln01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mln00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    A9174_32585
Enzymes [BR:mln01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     A9174_32585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL PEP_hydrolase Dus Peripla_BP_1 ComA
Motif
Other DBs
NCBI-ProteinID: ANN60961
LinkDB All DBs
Position
complement(6778006..6778914)
Genome map
AA seq 302 aa AA seqDB search
MVERQSGAQTRESLRRMISSGELDFAMEAHDGLSAAIAERAGFKALWASGLSISSSLGYR
DANEASWSQLVDVVERISDTVDIPVLVDGDSGFGNFNNARLVARKLRQHGASGICLEDTA
FPKMNSFIGDRHPLADIPEFCGRLKAVKDQVPDAEFVLVARIEALIAGREEDEALARAQA
YAEAGADAILIHSRKSNAEQIFAFTRAWQNRLPVVIVPTKYYRTPVSAYRAAGISTVIWA
NHNMRAAISAMRQVCDRILREESIAGIEDEVATLDELFDLLNYQELSAAEEKYLPQTATG
VR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggtggagaggcagtctggtgcgcagacgcgcgagagcttgcgccgaatgatctcgtcc
ggtgaactcgacttcgcaatggaggctcatgacggcctttcggctgcgattgccgagcgc
gctggcttcaaggcgctctgggcgtccggcctctcgatttcatccagtctcggatatcga
gatgcgaacgaagcttcctggtcccaactcgtcgatgtcgttgagcgaatttccgacacg
gtggacattccagtcctcgtcgacggggacagcgggttcgggaacttcaacaatgcccgt
ttggtcgcccgcaagctgcgccaacatggcgcgagcggcatatgtctcgaggacacggcg
ttcccgaaaatgaactcgtttatcggtgatcggcacccgttggccgatattcccgagttc
tgcggccggcttaaggcggtgaaggaccaagtgccggatgcggagttcgttctggtcgcc
cggatcgaggcgctcatcgccggccgcgaagaggatgaggcgctggcgcgagcacaagcc
tacgctgaggccggcgccgatgctattctgattcattcccgcaagtccaacgctgagcag
attttcgccttcacgcgcgcctggcagaaccgccttccggtcgtgatcgtgcctacgaaa
tattaccgcacaccggtctccgcgtatcgggcggccggaatctccacggtcatctgggcg
aaccacaacatgcgcgcggcgatatcggccatgcgccaggtctgcgaccgcatcctccgc
gaagaaagtatcgccggtatcgaggacgaggtggcgaccctcgatgaactcttcgatctg
ctcaattaccaggaactctcagcggcggaagagaaatatctgccgcagacggcgaccggc
gtgcggtag

DBGET integrated database retrieval system