KEGG   Mesorhizobium japonicum MAFF 303099: mll1553
Entry
mll1553           CDS       T00043                                 

Definition
(GenBank) UDP-N-acetylmuramate-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00471  D-Glutamine and D-glutamate metabolism
mlo00550  Peptidoglycan biosynthesis
mlo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    mll1553
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    mll1553
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mlo01011]
    mll1553
Enzymes [BR:mlo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     mll1553
Peptidoglycan biosynthesis and degradation proteins [BR:mlo01011]
 Precursor biosynthesis
  Amino acid ligase
   mll1553
SSDB
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C
Other DBs
NCBI-ProteinID: BAB48900
RhizoBase: mll1553
UniProt: Q98KB4
LinkDB
Position
complement(1292088..1293488)
AA seq 466 aa
MKMPQTIGLVHFIGIGGIGMSGIAEVLHNLGYKVQGSDQADSANVQRLRDKGIECFVGHK
AENLGDAEVVVVSTAIKKTNPELKAAREKLLPIVRRAEMLAELMRFRQAVAIGGTHGKTT
TTSMVATLLEAGGLDPTVINGGIINAYGTNARMGDGEWMVVEADESDGTFLKLPADIAVV
TNIDPEHLDHYGSFDKVREAFRQFVENVPFYGFGVMCTDHPEVQALVGRIEDRRVITYGE
NAQADVRFTNHRMAGATSEFDVVIRDRKTGSQSTISGLRLPMPGRHNVSNATAAIAVAHE
LGLSGEAIKKGLSSFAGVKRRFTHTGSWNGVDVFDDYGHHPVEISAVLKAARSATKGRVI
AIAQPHRFTRLHDLFNEFSACFNDADTVIVAPVYAAGEDPIDGVSSDELVSRIRAGGHRD
ARYIEGPTAIAPIIRGLAKPGDFVVFLGAGNITQWAYALPKELAAS
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgaagatgccgcagaccatcggccttgtgcatttcatcggcattggcggcatcggcatg
agcggcatcgccgaggtgctgcacaatctcggttacaaggtgcaagggtccgaccaggcc
gacagcgccaatgtgcagcggctgcgcgacaagggcatcgaatgcttcgtcggccacaag
gccgagaatctcggcgatgccgaggtggtggtcgtctcgacggcgatcaagaagaccaat
ccggaactgaaggccgcgcgcgaaaagctgctgccgatcgtgcgccgcgccgaaatgctg
gccgagctgatgcgctttcgccaggcggtggcgatcggcggcacgcatggcaagacgacg
acgacctcgatggtcgcgaccttgctcgaagccggcgggctcgatccgaccgtcatcaat
ggcggcatcatcaatgcctatggcaccaatgcgcgcatgggcgacggcgagtggatggtg
gtcgaggccgacgagagcgacggcaccttcctcaaattgccggccgacatcgccgtcgtc
accaacatcgatcccgaacatctcgaccactatggcagtttcgacaaggtgcgcgaggcg
ttccgccagttcgtcgagaacgtgccgttctacggctttggcgtgatgtgcaccgaccat
cctgaagtgcaggcgctggtcggccgcatcgaggaccgccgcgtcatcacctacggcgag
aacgcgcaagccgatgtgcgcttcaccaaccaccgcatggcgggcgccacctccgaattc
gacgtggtgatccgcgaccgcaagaccggcagccagagcacgatttcaggcctgcgcctg
ccgatgcccggccgccacaatgtctccaacgccaccgccgcgatcgccgtcgcgcatgag
ctcggcctgtccggcgaggcgatcaagaagggcctgtcgtccttcgccggcgtcaagcgc
cgcttcacccataccggatcctggaacggcgtcgatgtgttcgacgattacggccaccat
ccggtcgagatctcggcggtgctgaaggcggcgcgcagcgccaccaagggccgcgtcatc
gccattgcccaaccgcaccgcttcacccggctccacgatctgttcaacgagttctccgcc
tgcttcaacgacgccgacacggtgattgtcgcgccggtctatgctgccggcgaagacccg
atcgacggcgtcagctcggacgaactggtgtcgcgcatccgcgccggcggtcatcgtgac
gcgcgctatatcgaggggccgacagcgatcgcgccgatcattcgcggcctggccaagccc
ggcgacttcgtcgtcttcctcggcgccggcaacatcacccaatgggcctatgctctgcca
aaggagcttgccgcctcatga

DBGET integrated database retrieval system