KEGG   Mesorhizobium japonicum MAFF 303099: mll3571Help
Entry
mll3571           CDS       T00043                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01130  Biosynthesis of antibiotics
mlo01230  Biosynthesis of amino acids
Module
mlo_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    mll3571
Enzymes [BR:mlo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     mll3571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: BAB50435
RhizoBase: mll3571
UniProt: Q98FY1
LinkDB All DBs
Position
complement(2878204..2879340)
Genome map
AA seq 378 aa AA seqDB search
MSADQPVTVEVGLGDRAYDILIGSGLLSRAGEEISRRLPGTRAAVVTDENVAAAHLDTLK
AGLEKGGIQPTVITMPPGEKTKSFAHLEEVVDGILAARLERGDVVIALGGGVIGDLTGFS
AGIVRRGMNFVQVPTSLLAQVDSSVGGKTGINSPRGKNLVGVFLQPKLVLADTEVLDTLP
IREFRAGYAELAKYGLIDRPELFAWLEANWQKVFAGGPERAQAIAEACRAKADVVARDEF
ETGDRALLNLGHTFGHALEAATQYDGARLVHGEGVAIGMALAHRFSSRLNLASPDDAARV
ETHLRAVGLPWRMADIPGELPDAEALLAFITQDKKVSRGALTFILTRGIGQAFIAKDVPA
SEVLSFLRENHPTSRKAG
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcggaccagccagtcaccgtcgaagtcggccttggcgaccgggcctacgacata
ttgatcggctccggccttttgtcgcgcgccggcgaagagatttcgcgccggctgccgggt
acgcgcgcggctgtcgtcaccgacgagaatgtcgctgccgcgcatctcgatacgttgaag
gcagggctcgagaagggtggcatccagcccaccgtcatcacgatgccgcccggcgagaag
accaagagctttgcccatctcgaagaggtggtcgatgggattctggccgcaaggctggag
cgtggcgacgtcgtcatcgcgctgggcggcggcgtcatcggcgatctcaccggtttttcc
gcgggcatcgtgcggcgcggcatgaatttcgtacaggtcccgacctcgctgctggcgcag
gtcgattcctcggtgggcggcaagaccggcatcaacagcccgcgcggcaagaaccttgtc
ggcgtcttcctgcagccgaaactggtgctggccgacacggaagtgctcgacacgctgccg
atccgcgaattccgcgccggctatgccgaactcgccaagtacgggctgatcgaccggccg
gaacttttcgcttggctggaggcgaactggcagaaggtgttcgccggcgggccggagcga
gcgcaggcgattgccgaagcctgccgcgccaaggccgatgtcgtcgcgcgcgacgagttc
gagaccggcgaccgggcgctcctcaatctcggccacacattcggccatgcgctcgaagcc
gccacgcagtatgacggcgcccgcctcgtccatggcgagggggtcgccatcggcatggcg
ctggcgcatcgcttctcctcgcggctcaatctggccagccccgacgacgcggcacgcgtc
gagacgcatctgcgcgccgttggcctgccgtggcggatggccgatattccaggtgaattg
cccgatgccgaggcgctgcttgccttcatcacccaggacaagaaggtttcgcgcggcgcg
ctgaccttcatcctgacgcgcggcatcggccaggctttcatcgccaaggacgttccggct
tcggaagtgctgtcgttcctgagggaaaaccatccaaccagccggaaagccggctga

DBGET integrated database retrieval system