KEGG   Mesorhizobium japonicum MAFF 303099: mll6639Help
Entry
mll6639           CDS       T00043                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00010  Glycolysis / Gluconeogenesis
mlo00620  Pyruvate metabolism
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mll6639
   00620 Pyruvate metabolism
    mll6639
Enzymes [BR:mlo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     mll6639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: BAB52891
RhizoBase: mll6639
UniProt: Q988Q6
LinkDB All DBs
Position
complement(5436205..5437722)
Genome map
AA seq 505 aa AA seqDB search
MNKVEFSRPVKAPFDKRYGNFIGGKWTEPRSGRYFENHSPVNGQLLCEVARSDADDIEAA
LDAAHAAKDAWGRTSVAERSLILNRIADRMEENLDLLACAETWDNGKPIRETTVADLPLA
IDHFRYFASAVRGQEGSLSQIDDDTVAYHFHEPLGVVGQIIPWNFPLLMACWKLAPALAA
GNCVVLKPAEQTPAAILLWADLIGDLLPPGVLNIVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVVAEDDDFFDKAIEGFVMFALNQGEVC
TCPSRALIHESIYDRFMERALKRVEAIVQGDPLDPATMIGAQASSEQLEKILSYIDIGRQ
EGAEVLTGGARNVLPGDLAGGYYVKPTVFRGHNKMRIFQEEIFGPVVSVTTFKDDDEALS
IANDTLYGLGAGVWTRDGNRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETH
KMMLDHYQQTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggttgaattctcacgcccggtcaaggcgcccttcgacaagcgttacggcaat
ttcatcggcggcaaatggaccgaaccccgctccggccgctacttcgagaaccactcgccg
gtgaacggtcagttgctgtgcgaggtggcgcgctcggatgccgacgacatcgaggcggct
ctggacgcggcccatgccgccaaggacgcctggggacgcaccagcgtggcagagcggtcg
cttattctcaaccgcatcgccgaccgcatggaggagaacctcgatctcctcgcctgcgct
gaaacatgggacaacggcaagccgatccgcgaaacgaccgtcgccgacctgcctctggcc
atcgaccatttccgctatttcgccagtgccgtgcgcggccaggaggggagcctctcgcaa
atcgacgacgataccgtcgcctatcacttccatgagccgctcggcgtggttggccagatc
attccctggaacttcccgctgctgatggcatgctggaagctcgcgcccgcgcttgcggcc
ggcaactgcgtggtgctgaagcccgccgagcagaccccggccgccatcctgctctgggcc
gatcttatcggcgatctgctgccgccaggcgtgctcaacatcgtcaacggcttcggcctc
gaggccggcaagccactcgcgtcgtcgccgcgcatcgccaagatcgcctttaccggcgag
accacgacgggccggctgatcatgcaatatgccagccagaacctcatccccgtcacactg
gaattgggcggcaagtcgcccaacatcttcttcaaggacgtcgtcgccgaggacgacgat
ttcttcgacaaggccatcgaaggcttcgtcatgttcgcgctgaaccagggggaggtctgc
acatgcccgagccgtgcgctcatccatgaatcgatctacgacaggttcatggaacgtgcc
ctcaagcgcgtcgaagccatcgtccagggcgatccgctcgacccggcgacgatgatcggc
gcccaggcctcgtcggagcagctggaaaagatcctgtcctacatcgacatcggccgccag
gaaggcgccgaggtgctgaccggcggcgcccgcaatgttctgcccggcgacctggcgggc
ggctattacgtcaagccgaccgtgttcaggggccacaacaagatgcgcatcttccaggaa
gagattttcggaccggtggtttcggtcacgaccttcaaggacgacgacgaagcgctcagc
attgccaacgacacgctctacggccttggcgccggcgtctggacacgtgacggcaaccgc
gcctatcgcttcggccgcgcaatccaggccggccgcgtctggaccaactgttaccacgcc
tatccggcgcatgcggccttcggcggctacaagcagtccggcatcggccgcgagactcac
aagatgatgctcgaccactatcagcagaccaagaacatgcttgtcagctatagcccgaag
aagctcggcttcttctga

DBGET integrated database retrieval system