KEGG   Mesorhizobium japonicum MAFF 303099: mll9625Help
Entry
mll9625           CDS       T00043                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    mll9625
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mlo03400]
    mll9625
Enzymes [BR:mlo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     mll9625
DNA repair and recombination proteins [BR:mlo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     mll9625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: BAB54816
RhizoBase: mll9625
UniProt: Q98P39
LinkDB All DBs
Position
pMLb:complement(90698..93349)
Genome map
AA seq 883 aa AA seqDB search
MASDKLTTYKAKRDFKKTQEPSGQGSVKPSNRRRFVIQKHDATRLHYDLRLELGGVFKSW
AVTRGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVMLWDRGYWEPEGKNSPE
QALAKGDFKFTLEGERLHGSFVLVRMANDRERGKRTNWLLIKHRDEYAVETNGAAILDKN
DTSVASGRKMEAIAAGKGRSPKPFMLQGGKAEADAVWDSRTGLAAQERKTNIRAKRKKHG
TVTAADLPDFIAPQLCQTLARPPSESGWLHEIKFDGYRIQMRVLGGEAILQTRKGLDWTA
RYRAIARAAGNLPDAIIDGEICALDENGAPDFAALQAALAEGKTDALVYFAFDLLFEGAE
DLRVLPLSKRKARLRQFLTDTGEDDRIRFVEHFETGGEAVLRSACRLSLEGIVSKRADAP
YVSGRTETWAKSKCRAGHEVVIGAYATTNGKFRSLLVGVYRGDHFVYVGRVGTGYGAAKV
RDLLPKLKAAATRKSPFTGIGAPKNEPGVVWLKPELVAEIEFAGWTSDGLVRQAAFKGLR
EDKPAEEVEADKPASPEKTKVPQPREPTAAAKPSRSRGKVDVMGVLISNPDKPLWPDAND
GIPVTKEDLARYYEAVGPWLIEHIRGRPCSIIRAPDGFGGEQFFQRHAMPGTSNLLELVE
VFGDKKPYLQIDRVEGLAAVAQIGALELHPWNCEPQQPEVPGRLVFDLDPGPDVPFKTVV
EAAKEMRARLDDLGLVSFCKTTGGKGLHVVTPLAVTKRSKLTWPEAKGFAHDVCLQMARD
NPALYLTKMAKNQRIGRIFLDYLRNDRMATAVAPLSPRARPGATVSMPLTWAQVKTDLDP
KRFTLRTVPGLLAKSTAWKDYGDGHRLLEASIKRLARSMRRAA
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgacaagctaacaacatacaaggccaagcgcgatttcaagaagacgcaggag
ccgagcggtcaagggtcggtcaagccatccaaccgccgtcgtttcgtcattcagaaacat
gacgcgacgcggctgcattacgatctgcgacttgagctcggcggcgttttcaaatcctgg
gccgtgacgcgcggtccctctctcgatcctcatgacaagaggctcgcggtcgaggtggaa
gatcatccgctcgactacggggatttcgaagggacgattccaaaaggccagtatggcggc
ggcacggtcatgctgtgggaccgcggctattgggagcccgagggaaagaacagccccgag
caggcgctggccaagggcgatttcaaattcacgctcgaaggggagcggctgcatggcagt
ttcgtgctggtgaggatggccaacgaccgcgaacgcggcaagcgcaccaactggctgctg
atcaaacatcgcgacgaatatgccgtcgagacaaacggggctgcaatcctcgacaagaat
gacacctctgtcgcatccggacgcaagatggaggcaattgctgccggcaagggccgcagc
ccgaaacccttcatgctgcaaggcggcaaggccgaggcagatgcggtgtgggacagtcgt
acaggcttggcggcgcaggaacggaaaacaaacattcgcgcaaaaaggaagaagcacggg
actgtcactgccgccgatcttcccgacttcattgccccacagctctgccagacgctggcg
cggccgccctctgagagcggatggctgcacgagatcaagttcgacggctatcgcatccag
atgcgcgtcctgggcggcgaagctatcttgcagacccgcaagggtctcgactggaccgcc
agatatcgcgccattgcccgagccgccggcaatctgcccgatgcgatcatcgacggcgag
atctgcgcgcttgacgaaaacggcgccccggatttcgccgccctccaggcagcgctggcc
gagggcaagaccgatgcgcttgtctacttcgccttcgacctgctgttcgaaggcgctgag
gatttgcgtgtcttgccattgagtaagcgcaaggcgcgattgcgtcagtttctgaccgac
acgggtgaggacgatcgcatccgcttcgttgagcatttcgaaactggcggcgaggcagtg
cttcgctcggcctgccggctgtccttggaaggcatcgtttcgaagcgcgccgatgcgccc
tacgtttccggccgtaccgagacgtgggcgaagtcaaaatgtcgcgcaggccacgaggtc
gtcatcggcgcctatgccacaacgaatggcaaattccggtcgcttctggtcggcgtctat
cgcggcgatcacttcgtctatgtcgggcgcgtgggcacaggctatggcgcagccaaggtc
agggacctgctgccgaagttgaaagctgccgcgacccggaaatcacctttcaccggcatc
ggcgcgccaaagaacgaacccggcgttgtctggctgaagccggaactggtggccgagatc
gaattcgccggctggacgtccgacgggctcgtgcgccaagccgccttcaaaggcttgcgt
gaggacaaaccggccgaggaggtcgaagccgataagcctgcctcgccggaaaagaccaag
gtgccccagccgcgggagccgaccgcagcagccaagccttcccgcagccgcggcaaggtc
gatgtcatgggtgtgctgatctcgaatccggacaagccgctgtggccggatgccaatgat
ggcatccccgtaaccaaggaagatctcgcccgctattacgaagctgtcggtccctggctg
atcgagcacatccgcgggcggccctgctcaatcatccgcgcgccggatggattcggcggc
gagcagttcttccagcgtcatgcgatgccgggaacgtcaaatcttcttgaactggtggag
gtgttcggcgacaagaagccctacctacagatcgaccgtgtggagggtctcgccgccgtc
gcccagatcggtgcgctggaattgcatccctggaattgcgagccacagcagcccgaggtg
ccgggccggctcgtcttcgatcttgatccaggtcccgacgtcccgttcaaaacggttgtc
gaggcggctaaggaaatgcgcgcgcgcctcgacgatcttgggctcgtcagcttctgcaag
acgactggcggcaaagggctgcacgtcgtcacgcccttagcggtcaccaagcgcagcaag
ctcacctggccagaggcaaaagggtttgctcatgatgtctgcctgcagatggcgcgggac
aatcccgccctctacctgaccaagatggcgaagaaccagcgcatcggccgcatcttcctc
gactatctgcgcaacgatcgcatggcgaccgccgtggctccgctgtcgccgcgggccagg
cccggcgcgacagtctccatgccgctcacctgggcacaggtcaaaaccgatctcgatccg
aagcgcttcaccctgcgcaccgtgcccgggctgctggcaaagagcacggcctggaaggac
tatggcgatggccatcgcctcctggaagcatccatcaagcgactggcaagatcgatgcgg
cgggcggcctga

DBGET integrated database retrieval system