KEGG   Mesorhizobium japonicum MAFF 303099: mlr0263Help
Entry
mlr0263           CDS       T00043                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mlo03012]
    mlr0263
   03029 Mitochondrial biogenesis [BR:mlo03029]
    mlr0263
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mlo04147]
    mlr0263
Translation factors [BR:mlo03012]
 Eukaryotic type
  Elongation factors
   mlr0263
 Prokaryotic type
   mlr0263
Mitochondrial biogenesis [BR:mlo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    mlr0263
Exosome [BR:mlo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   mlr0263
  Exosomal proteins of breast cancer cells
   mlr0263
  Exosomal proteins of colorectal cancer cells
   mlr0263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: BAB47886
RhizoBase: mlr0263
UniProt: Q981F7
LinkDB All DBs
Position
185097..186272
Genome map
AA seq 391 aa AA seqDB search
MAKGKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGEYKRYDQIDAAPEEKARGITIST
AHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPSIVVFLNKVDQVDDAELLELVELEVRELLSKNEFPGDDIPIVKGSALAALEDSNKT
IGEDAIRELMAQVDAYIPTPVRPLDKPFLMPIEDVFSISGRGTVVTGRVERGVVKVGEEL
EIIGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDREGVERGQVLAKPGTVKPHK
KFVAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGIVSLPAGTEMVMPGDNITVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVVTIKE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaaattcgagcgcactaagcctcatgtgaacatcggcacgattggtcac
gttgaccatggcaagacgtcgctgacggcggcgatcacgaagtattttggcgagtacaag
cgctacgaccagatcgatgcggcgccggaagagaaggcacgcggcatcaccatttcgacg
gctcacgtcgaatacgagacggccaaccgccactacgcccacgtcgactgccccggccac
gccgactatgtgaagaacatgatcaccggcgccgcgcagatggacggcgcgatcctggtg
gtgtcggccgccgacggcccgatgccgcagacccgcgagcacatcctgcttgcccgtcag
gtcggcgtgccgtcgatcgtggtgttcctgaacaaggtcgaccaggtcgacgacgctgag
ctgctcgaactggtcgagctcgaggttcgcgagcttctgtcgaagaacgagttccccggc
gacgacattccgatcgtcaagggttcggcgctggctgctcttgaggattccaacaagacg
atcggcgaggacgcgatccgcgagctgatggctcaggtcgacgcctacatcccgaccccg
gttcgtccgctcgacaagccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgcggcacggtcgtgaccggccgcgtcgagcgcggcgtggtcaaggtcggcgaggagctg
gagatcatcggcatccgtccgacgaccaagacgacctgcacgggcgtggaaatgttccgc
aagctgctcgatcagggccaggctggcgacaacatcggcgcgctgctgcgtggcgttgat
cgtgaaggtgtcgagcgcggccaggtcctggccaagccgggtacggtgaagccgcacaag
aagttcgtggccgaagcctacatcctgaccaaggacgaaggtggccgtcacacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgacggacgtgaccggcatcgtgtcg
ctgccggctggcaccgagatggtcatgcctggcgacaacatcacggtcgatgtcgagctg
atcgtaccgatcgccatggaagagaagctgcgcttcgccatccgtgaaggcgggcgcacc
gtcggtgccggcatcgtcgtcaccatcaaggaataa

DBGET integrated database retrieval system