KEGG   Mesorhizobium japonicum MAFF 303099: mlr2747Help
Entry
mlr2747           CDS       T00043                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00240  Pyrimidine metabolism
mlo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    mlr2747
Enzymes [BR:mlo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     mlr2747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 DUF3331 DUF2075
Motif
Other DBs
NCBI-ProteinID: BAB49802
RhizoBase: mlr2747
UniProt: Q98HR4
LinkDB All DBs
Position
2206617..2207228
Genome map
AA seq 203 aa AA seqDB search
MAKLYFNYATMNAGKTTMLLQASYNYRERGMTTMLFVAGHYRKGDSGLISSRIGLETEAE
MFRDGDDLFARVAEHHDHTTVHCVFVDEAQFLEEEQVWQLARIADRLNIPVMCYGLRTDF
QGKLFSGSRALLAIADDLREVRTICRCGRKATMVVRLGADGKVARQGEQVAIGKDVYVSL
CRRHWEEEMGRAAPDDFIGFMKS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctacttcaactacgcaacgatgaatgccggcaagacgacgatgctcttg
caggcctcgtataattatcgcgagcgcggcatgacgacgatgctgttcgtcgccggccac
taccgcaagggcgacagcggcctgatctcgtcgcgcatcggactggagaccgaggcggag
atgttccgcgacggcgacgatttgttcgcccgcgtcgccgaacatcacgaccatacgacg
gtgcattgcgtcttcgtcgacgaggcgcagttcctcgaggaggagcaggtctggcaattg
gcccgcatcgccgaccggctgaacatcccggtcatgtgctacggcctgcgcaccgatttc
cagggcaagctgttttccggctcgcgcgcgctgctggcgatcgccgacgatctgcgcgag
gtgcgcaccatctgccgctgcggccgcaaggcgacgatggtcgtgcgcctcggcgccgat
ggcaaggtggcccgccagggcgaacaggtggcgatcggcaaggatgtctatgtttcgctc
tgccgccgtcactgggaagaagaaatgggccgcgccgcgcccgacgatttcatcggcttc
atgaaatcctga

DBGET integrated database retrieval system