KEGG   Mesorhizobium japonicum MAFF 303099: mlr4205Help
Entry
mlr4205           CDS       T00043                                 

Definition
(GenBank) glucoamylase; glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00500  Starch and sucrose metabolism
mlo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    mlr4205
Enzymes [BR:mlo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     mlr4205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 Prenyltrans
Motif
Other DBs
NCBI-ProteinID: BAB50916
RhizoBase: mlr4205
UniProt: Q98EK2
LinkDB All DBs
Position
3358246..3360660
Genome map
AA seq 804 aa AA seqDB search
MAVTPIVPPGAPGIPARWTSSAKSGVGTSLSPAGHIWFTISHGILEVYYPRLDSACTRDL
GLIVTGPGGYFSEEKRDAAHEIEPFEAGVPAYRLVNTAGDGAYRIEKRILCDPARPVLLQ
EITFTALKGAPDDYRVYALLAPHLVNAGMGNTAWVGDHKGKPVLFASGRGSCLALASSLP
WRDCSAGYVGFSDGWQQLNHTGILDQACQRAEDGNVALTGEIGFTSTTTKAVLALGFGAT
PDEAAENAFASLEQGFEPAAKTYLQNWREWQARLLPLDRHAASGINTYRTSTAVLATHRS
IAMPGAAVASLSIPWGFNKGDDDLGGYHLVWPRDLVETAGGFLAAGDAASALQILEYLRS
IQQPDGHWPQNAWLDGSAYWPGIQMDECAFPLLLADALHRAGHLPRARLATLLPMIERAA
TYVVRNGPVTGEDRWEEDAGYSPFTLAVEIAALLAAADLLDACGKKDEATYLRETSDGWN
DQLERWTYATDTAICRAAGVEGYYVRIAPPDSAEAGSPKDGYVPIKNRPPGDTDRPAQEI
VSPDALALVRFGLRSADDPRIVDTVKVIDAQLRCALPQGPIWYRYNGDGYGEHQDGTPFD
GTGQGRPWPLLAGERAHYELAAGRKDEAANLLKALEDSAEPGGLLPEQVWDGADLPERQL
LHGRPSGSAMPLVWAHSEHIKLLRSLRDGAVFDMPPQGVKRYIEAKTVSPFRTWRFNNKI
RALPEGKTLRIELLAAATVHWSTDNWATAHDSQTVENAFGIHLADLPTTSLPEGSALIFT
FFWPGTGDWENVDFSVTSGERDSG
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgacgccgatcgttcccccgggcgcaccgggcattccggcgcgctggacatcg
agcgccaagagcggcgtcgggacgtcgctttcgccggccggccacatctggttcaccatc
agccacggcatcctcgaagtctactatccacggctcgacagcgcctgcacgcgcgatctc
ggcctgatcgtcaccggtcccggcggctatttctccgaagagaagcgcgatgccgcgcat
gaaatcgagcccttcgaggccggcgtgcccgcctaccggctggtcaacacggccggcgac
ggcgcctaccgcatcgagaagcgcatcctctgcgaccctgcgcggcccgtgctgctgcag
gaaatcaccttcacggcgcttaaaggtgcgcccgacgattaccgcgtctacgcgcttctg
gcgccgcatctggtcaatgccggcatgggcaacaccgcctgggtcggcgaccacaaggga
aagcccgtgctgttcgcctcgggccgcggctcttgcctggcgctggcctcgtcgctgccc
tggcgggactgttcagccggctatgtcggcttctccgacggctggcagcagctcaatcat
accggcatccttgatcaggcttgccaacgggcggaagacggtaatgtcgcactgaccggc
gagatcggctttacatcaacaacgacaaaagccgtgctggcgctgggtttcggcgcgaca
ccggacgaggccgccgaaaatgccttcgccagtctggaacagggctttgagcccgcagcc
aagacctacctccagaattggcgcgaatggcaggcgcggctgctgcccctggaccggcac
gcggcatccggcatcaacacctatcgcacctcgaccgcggttctggcgacgcaccgctcc
atcgccatgccgggcgcggcggtcgcaagcctgtccattccctggggcttcaacaagggc
gacgacgaccttggcggctaccatctggtctggccgcgcgatctggtcgagactgcgggc
ggcttcctcgccgccggcgacgccgcctcggcgctgcagatccttgagtatctgcgctcc
atccagcagccggacggccattggccgcaaaatgcctggctcgacgggtcggcctattgg
cccggcatccagatggacgagtgcgcctttccgctgcttctggccgacgccttgcaccgc
gccggccatctgccgcgcgccaggcttgccaccttactgccgatgatcgaacgcgccgcg
acctatgtcgtgcgcaatggacccgtcaccggcgaagaccgctgggaagaggatgccggc
tacagcccgttcacgcttgccgtcgagatcgccgccctgcttgctgcggccgacctgctc
gacgcctgcggcaagaaggacgaagcaacctatctgcgcgagacatcagatggctggaac
gaccagcttgagcgctggacctatgccaccgacacggcgatctgcagggcagccggcgtc
gaaggttattatgtccgtatcgcgccacccgacagcgccgaggccggctcgcccaaggac
ggctatgtcccgatcaagaaccggccgcccggcgacaccgaccgcccggcgcaggaaatc
gtcagccccgacgcgctggcgctggtgcgctttggcctgaggtcggccgacgacccgcgc
atcgtcgacacagtcaaggtcatcgacgcgcagttgcgctgcgcgctgccgcagggcccg
atctggtatcgatacaatggcgacggctatggcgaacaccaggacggcacgcctttcgac
ggtaccggccagggccggccctggccgcttctggccggcgagcgcgcccattatgagctg
gcggcggggcgcaaggatgaggcggccaacctgctcaaggcgctggaggattcggccgag
ccgggcggcctgctgccggagcaggtctgggatggcgccgacctgcccgagcgccaattg
ctgcatggccgcccctcgggcagcgccatgcccctggtctgggcgcactccgagcatatc
aagctgctgcgctcgctgcgcgacggcgccgtcttcgacatgccgccgcaaggcgtgaag
cgctacatcgaggccaagaccgtatcgccattcaggacctggcgcttcaacaacaagatc
cgcgcgctgcccgaaggcaagacgctgcgcatcgaattgctggccgcggccacggtgcat
tggagcaccgacaattgggcaaccgcccatgacagccagacggtggaaaatgccttcggc
atccatcttgccgatttgcccacgaccagcctccccgagggaagcgcgctgatcttcact
tttttctggcccggaaccggcgattgggagaatgtcgacttctccgtcacatcaggcgag
cgggatagcggctaa

DBGET integrated database retrieval system