KEGG   Mesorhizobium japonicum MAFF 303099: mlr5521Help
Entry
mlr5521           CDS       T00043                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00250  Alanine, aspartate and glutamate metabolism
mlo00410  beta-Alanine metabolism
mlo00640  Propanoate metabolism
mlo00650  Butanoate metabolism
mlo01100  Metabolic pathways
mlo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    mlr5521
   00650 Butanoate metabolism
    mlr5521
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    mlr5521
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    mlr5521
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mlo01007]
    mlr5521
Enzymes [BR:mlo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     mlr5521
Amino acid related enzymes [BR:mlo01007]
 Aminotransferase (transaminase)
  Class III
   mlr5521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAB51958
RhizoBase: mlr5521
UniProt: Q98BL4
LinkDB All DBs
Position
4431232..4432521
Genome map
AA seq 429 aa AA seqDB search
MKDIMKNSAISERKNQSISRGVGMTTQIYADRAENSEIWDVEGRRYIDFSSGIAVVNTGH
RHPRVIEAVKAQLDRFTHTCHQVVPYESYVRLAERLNAMLPGKFEKKTIFVTTGAEAVEN
AIKIARNATGRPAVIAFAGGFHGRTFMGMALTGKVVPYKVGFGAMPGDVYHAPFPVPLHG
VSVADSLAALDRLFKADVDPARVAAIIVEPVQGEGGFYEAPREFLTALRKLCDQHGMLLI
ADEVQTGFARTGKMFAMDHHEVAADITTMAKSLAGGFPLSAVTGRAEIMDAPGPGGLGGT
YGGSPIGVAAAHAVLDVIEDEKLCDRANTLGARLKQRLQSIRDDVPEIVDIRGLGFMNAV
EFNDVKKGMPSAEIANAIRLKALDKGLILLTCGVYGNVIRFLAPITIQDEVMNEALDILE
SSIREVCAA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatatcatgaagaattcagccatttccgaacgcaaaaaccagtcgatctcgcgc
ggcgtcggcatgaccacgcaaatctacgccgaccgggctgaaaattcggaaatctgggat
gtcgaaggccgtcgttacatcgatttttcctcgggcatcgccgtcgtcaacaccggccac
cgccatcccagggtgatcgaagcggtcaaggcgcagctcgaccgcttcacccacacctgc
caccaggtcgtgccctatgagagctatgtgcggctggccgaacggctgaacgccatgctg
cccggcaagttcgagaagaagacgatcttcgtcaccaccggcgccgaggcggtcgagaac
gccatcaagatcgcccgcaatgccaccggccgcccggccgtcatcgccttcgccggcggc
ttccatggccgcaccttcatgggcatggcgctgaccggcaaggtcgtgccctacaaggtc
ggcttcggcgccatgccgggcgacgtctatcacgcgccgttcccggtgccgctgcacggc
gtttcggttgccgattcgctcgcagcgctcgaccggctgttcaaggccgacgtcgatccg
gcccgcgtcgccgccattatcgtcgagccggttcagggcgagggcggtttctacgaggca
ccgcgcgaattcctgaccgcgctgcgcaagctctgcgaccagcacggcatgctgctcatc
gccgacgaggtgcagaccggctttgcccgcaccggcaagatgttcgcgatggatcaccac
gaagtcgccgccgacatcaccaccatggccaagagcctggccggcggcttcccgctgtcg
gccgtcaccggccgcgccgagatcatggatgcgcctggccccggcggcctcggcggcacc
tatggcggcagcccgatcggcgttgccgccgcgcatgccgtgcttgacgtgatcgaggac
gaaaagctgtgcgaccgcgccaacacgctgggcgcgcggctgaagcagcgcctgcagtcg
atccgcgacgacgtgcccgaaatcgtcgatatcaggggcctgggcttcatgaacgcggtc
gagttcaacgacgtcaagaagggcatgccatcggccgagatcgccaacgccatccggctg
aaggcgctcgacaagggcctgatcctgctgacctgtggcgtctacggcaacgtcatccgc
ttcctcgcaccgatcaccatccaggacgaggtcatgaacgaggcgctcgacattctggaa
agctcgatccgcgaagtctgcgctgcctga

DBGET integrated database retrieval system