KEGG   Mesorhizobium japonicum MAFF 303099: mlr5521Help
Entry
mlr5521           CDS       T00043                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00250  Alanine, aspartate and glutamate metabolism
mlo00410  beta-Alanine metabolism
mlo00640  Propanoate metabolism
mlo00650  Butanoate metabolism
mlo01100  Metabolic pathways
mlo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    mlr5521
   00650 Butanoate metabolism
    mlr5521
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    mlr5521
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    mlr5521
Enzymes [BR:mlo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     mlr5521
Amino acid related enzymes [BR:mlo01007]
 Aminotransferase (transaminase)
  Class III
   mlr5521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAB51958
RhizoBase: mlr5521
UniProt: Q98BL4
LinkDB All DBs
Position
4431232..4432521
Genome map
AA seq 429 aa AA seqDB search
MKDIMKNSAISERKNQSISRGVGMTTQIYADRAENSEIWDVEGRRYIDFSSGIAVVNTGH
RHPRVIEAVKAQLDRFTHTCHQVVPYESYVRLAERLNAMLPGKFEKKTIFVTTGAEAVEN
AIKIARNATGRPAVIAFAGGFHGRTFMGMALTGKVVPYKVGFGAMPGDVYHAPFPVPLHG
VSVADSLAALDRLFKADVDPARVAAIIVEPVQGEGGFYEAPREFLTALRKLCDQHGMLLI
ADEVQTGFARTGKMFAMDHHEVAADITTMAKSLAGGFPLSAVTGRAEIMDAPGPGGLGGT
YGGSPIGVAAAHAVLDVIEDEKLCDRANTLGARLKQRLQSIRDDVPEIVDIRGLGFMNAV
EFNDVKKGMPSAEIANAIRLKALDKGLILLTCGVYGNVIRFLAPITIQDEVMNEALDILE
SSIREVCAA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatatcatgaagaattcagccatttccgaacgcaaaaaccagtcgatctcgcgc
ggcgtcggcatgaccacgcaaatctacgccgaccgggctgaaaattcggaaatctgggat
gtcgaaggccgtcgttacatcgatttttcctcgggcatcgccgtcgtcaacaccggccac
cgccatcccagggtgatcgaagcggtcaaggcgcagctcgaccgcttcacccacacctgc
caccaggtcgtgccctatgagagctatgtgcggctggccgaacggctgaacgccatgctg
cccggcaagttcgagaagaagacgatcttcgtcaccaccggcgccgaggcggtcgagaac
gccatcaagatcgcccgcaatgccaccggccgcccggccgtcatcgccttcgccggcggc
ttccatggccgcaccttcatgggcatggcgctgaccggcaaggtcgtgccctacaaggtc
ggcttcggcgccatgccgggcgacgtctatcacgcgccgttcccggtgccgctgcacggc
gtttcggttgccgattcgctcgcagcgctcgaccggctgttcaaggccgacgtcgatccg
gcccgcgtcgccgccattatcgtcgagccggttcagggcgagggcggtttctacgaggca
ccgcgcgaattcctgaccgcgctgcgcaagctctgcgaccagcacggcatgctgctcatc
gccgacgaggtgcagaccggctttgcccgcaccggcaagatgttcgcgatggatcaccac
gaagtcgccgccgacatcaccaccatggccaagagcctggccggcggcttcccgctgtcg
gccgtcaccggccgcgccgagatcatggatgcgcctggccccggcggcctcggcggcacc
tatggcggcagcccgatcggcgttgccgccgcgcatgccgtgcttgacgtgatcgaggac
gaaaagctgtgcgaccgcgccaacacgctgggcgcgcggctgaagcagcgcctgcagtcg
atccgcgacgacgtgcccgaaatcgtcgatatcaggggcctgggcttcatgaacgcggtc
gagttcaacgacgtcaagaagggcatgccatcggccgagatcgccaacgccatccggctg
aaggcgctcgacaagggcctgatcctgctgacctgtggcgtctacggcaacgtcatccgc
ttcctcgcaccgatcaccatccaggacgaggtcatgaacgaggcgctcgacattctggaa
agctcgatccgcgaagtctgcgctgcctga

DBGET integrated database retrieval system