KEGG   Mycobacterium lepraemurium: MLM_0018Help
Entry
MLM_0018          CDS       T05534                                 

Definition
(GenBank) serine/threonine-protein kinase PknA
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mlp  Mycobacterium lepraemurium
Brite
KEGG Orthology (KO) [BR:mlp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mlp01001]
    MLM_0018
Enzymes [BR:mlp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MLM_0018
Protein kinases [BR:mlp01001]
 Serine/threonine kinases: Other
  Bacterial family
   MLM_0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like Pkinase_fungal RIO1 ABC1
Motif
Other DBs
NCBI-ProteinID: ATA27166
UniProt: A0A250BM69
LinkDB All DBs
Position
complement(18412..19677)
Genome map
AA seq 421 aa AA seqDB search
MTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLKQEFSQDPEFIERFRAEARTTA
MLNHPGIAAVHDYGESQLDGEGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALDMLEQTG
RALQVAHAAGLVHRDVKPGNILVTPAGQVKITDFGIAKAVDATPVTQTGMVMGTAQYIAP
EQALGHDATPASDVYSLGVVGYEVVSGKRPFSGDGALTVAMKHIKEPPPPLPAELPPNVR
ELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPLRPSQSPPPGRASPAAIPSGPTTRAA
AVSSGRTAAPRRTRPATGGHRPPPARRTFSSGQRALLWAAGVLGALAIIIAVLIVINSRA
DQQQQPPPVTDTGTPPASAPPPTKTPSGSGARPGLRLDWPDDGTIGASGFRDGPARHWTS
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctgtctggcaggtaccgcctgcagcgcctgatcgccaccggcggcatgggtcag
gtctgggaggcggtcgacaaccggctgggccggcgcgtcgcggtcaaggtgctcaaacag
gagttctcccaggaccccgagttcatcgagcgattccgcgccgaggcgcgcaccacggcg
atgctcaaccacccgggcatcgcggccgtgcacgactacggcgagagccagctagacggc
gagggccgcaccgcgtatctggtgatggaactggtcaacggtgagccgctgaactcggtg
ctcaagcggaccggccggctgtcgctgcggcacgcgctggacatgctcgagcagaccggc
cgcgccctgcaggtcgcgcacgccgccggcctggtgcaccgcgacgtcaaaccgggcaac
atcctggtcaccccggcgggacaggtgaaaatcaccgacttcggtatcgccaaggccgtc
gacgccacgccggtgacccagaccggaatggtgatgggcaccgcccaatacatcgcaccc
gaacaggcgctgggtcacgacgccacccccgccagtgacgtgtactcgctgggagttgtt
ggctacgaagtggtttcgggcaagcggccattcagcggcgatggggcgctgacggtggcg
atgaaacacatcaaggagcctccgccgccgctgcccgcggagctgccgcccaacgtgcgc
gagctcatcgagatcaccctggtgaagaacccggcgatgcgctaccgcagcggggggccg
ttcgccgacgccgtcgccgcggtgcgcgccggtcgccggccgctgcggccgagccagtcc
ccgccgcccgggcgggcgtcaccggcggccattccgtccggcccgaccacccgggcggca
gcggtgtcctccgggcggaccgccgcgccgcggcggacccggccggccaccggcggccac
cgcccgcccccggcccggcgcaccttctcgtccggccagcgcgcgctgctgtgggccgcg
ggggtgctgggcgcgctggcgatcatcatcgcggtgctcatcgtcatcaactcccgcgcg
gaccagcagcaacagcccccgccggtcaccgacaccggaaccccgcccgcctcggcgccg
ccgccgaccaagacgccgagcggctccggggcccgaccgggcctgcggctggactggccg
gatgacggcacaattggggcgtctggattccgcgacggacccgcccgacactggacatcg
caatga

DBGET integrated database retrieval system