KEGG   Mycobacterium lepraemurium: MLM_1627Help
Entry
MLM_1627          CDS       T05534                                 

Definition
(GenBank) gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mlp  Mycobacterium lepraemurium
Pathway
mlp00250  Alanine, aspartate and glutamate metabolism
mlp00280  Valine, leucine and isoleucine degradation
mlp00310  Lysine degradation
mlp00410  beta-Alanine metabolism
mlp00640  Propanoate metabolism
mlp00650  Butanoate metabolism
mlp01100  Metabolic pathways
mlp01120  Microbial metabolism in diverse environments
Module
mlp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mlp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MLM_1627
   00650 Butanoate metabolism
    MLM_1627
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MLM_1627
   00280 Valine, leucine and isoleucine degradation
    MLM_1627
   00310 Lysine degradation
    MLM_1627
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MLM_1627
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mlp01007]
    MLM_1627
Enzymes [BR:mlp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MLM_1627
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     MLM_1627
    2.6.1.48  5-aminovalerate transaminase
     MLM_1627
Amino acid related enzymes [BR:mlp01007]
 Aminotransferase (transaminase)
  Class III
   MLM_1627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ATA28224
UniProt: A0A250BQ66
LinkDB All DBs
Position
complement(1580088..1581428)
Genome map
AA seq 446 aa AA seqDB search
MARLKQTRRLVTEIPGPASLELSKRRAAAVSHAVNVSVPVFVARAGGGIVEDVDGNRLID
LGSGIAVTTIGNSAPRVVDAVRAQVAEFTHTCFMVTPYESYVAVAETLNRITPGAGEKRS
VLFNSGAEAVENAVKVARAYTRKPAVMAFDHAYHGRTNLAMALTAKSMPYKGGFGPFAPE
IYRAPLSYPYRDGLLDKELTTDGEKAAARAIDIIDGQIGADSLAAVIIEPIQGEGGFIVP
AEGFLPTLLDWCHRNDVLFIADEVQAGFARSGAMFACEHEGIEPDLICTAKAIADGLPLS
AVTGRAQIMDAPHVGGLGGTFGGNPLACAAALATIETIESDGLVERARQLERLITEPLLR
LQARDDRIGDVRGRGAMIAIELVKSGTAEPDKDLTQRLSVAAHAAGVIVLTCGMFGNIIR
LLPPLTISDELLAEGIDILGGLLADL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtggccaggctcaagcagactcgccggctggtcaccgagatccccggcccggcgtcgctg
gaactaagcaaacgccgcgcggccgcggtgtcgcacgcggtcaacgtgtcggtgccggtg
ttcgtcgcccgcgccggcggcggcatcgtcgaagacgtcgacggcaaccggctcatcgac
ctcggctccggcatcgccgtgaccaccatcggcaactcggcgccccgggtggtcgacgcg
gtgcgcgcccaggtggccgagttcacccacacctgcttcatggtgacgccgtacgagtcc
tacgtcgccgtcgccgaaacgctgaaccggatcacccccggggccggtgaaaagcgctcg
gtgctgttcaactccggcgccgaggccgtcgagaacgccgtcaaggtcgcccgcgcctac
acccgtaagccggccgtgatggccttcgaccacgcctaccacggccgcaccaacctggcg
atggcgctgaccgcgaagtcgatgccctacaagggcggcttcggcccgttcgcgccggag
atctaccgggcgccgctgtcctacccctaccgggacgggctgctcgacaaggaactgacc
accgacggggagaaggccgccgcgcgggccatcgacatcatcgacggccagatcggcgcc
gacagcctggccgcggtgatcatcgaaccgatccagggcgagggcgggttcatcgttccc
gccgagggattcctgcccaccctgctggactggtgccaccgcaacgacgtgctgttcatc
gccgacgaggtgcaggccgggttcgcgcggtccggcgccatgttcgcctgcgagcacgag
ggcatcgagccggacctgatctgcaccgccaaggccatcgccgacgggctgccgctgtcg
gcggtcaccggccgcgcccagatcatggacgccccgcacgtcggaggcctgggcggcacc
ttcggcggcaacccgctggcgtgcgcggcggcgctggccaccatcgagaccatcgagagc
gacggcctggtcgagcgggcccggcagctggaacgcctgatcaccgaaccgctgctgcgc
ctgcaggcccgcgacgaccggatcggcgacgtccgcggccggggcgccatgatcgccatc
gaactggtgaagtccggcaccgccgagccggacaaggacctgacccagcggctgtccgtc
gccgcgcatgcggctggcgtcatcgtgctcacctgcggcatgttcggcaacatcatccgg
ctgctgccgccgctgaccatcagcgacgagctgctcgccgagggcatcgacattctcggc
gggttgttggccgacctgtaa

DBGET integrated database retrieval system