KEGG   Mycobacterium lepraemurium: MLM_3435Help
Entry
MLM_3435          CDS       T05534                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mlp  Mycobacterium lepraemurium
Pathway
mlp00564  Glycerophospholipid metabolism
mlp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mlp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MLM_3435
Enzymes [BR:mlp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MLM_3435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 GIDA 3HCDH_N NAD_binding_8 AlaDh_PNT_C Pyr_redox HI0933_like
Motif
Other DBs
NCBI-ProteinID: ATA29432
UniProt: A0A250BU75
LinkDB All DBs
Position
complement(3479706..3481460)
Genome map
AA seq 584 aa AA seqDB search
MSDPIHALGEPGSPASALGPRQRAAAWDRLGAEQFDVVVIGGGVVGSGSALDAATRGLKV
ALVEARDFASGTSSRSSKMFHGGLRYLEQLEFGLVREALYERELSLTTLAPHLVKPMPFL
FPLTNRLWERPYIAAGIFLYDRLGGAKSVPAQKHLTRAGALRLCPGLKRSALIGGIRYYD
AVVDDARHTLTVARTAAHYGVVVRNSTQVVALLREGARVTGVRVRDSEDGSVTEVRGHVV
VNATGVWTDEIQALSKQRGRFQVRASKGVHVVVPRDRIVSDVAIILRTEKSVMFVIPWGS
HWIIGTTDTDWDLDLAHPAATKADIDYILSTVNTVLAIPLTHADIDGVYAGLRPLLAGES
EETSKLSREHAVAVPAPGLVAIAGGKYTTYRVMAADAIDAAAQFIPARVAPSITEKVSLL
GADGYFALINQAEHVAQLRGLHPYRVRHLLDRYGSLIGDVLALAADRPDLLNPITEAPGY
LRVEAMYAVTAEGALHLEDILARRMRISIEYSHRGVDCAREVADVVAPVLGWTAGDVERE
VVNYTARVQAEILSQAQPDDVSADELRASAPEARAEILEPVPLN
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatccgatccacgcactcggcgagcccggctcgccggcttcggcgctgggaccg
cggcaacgtgcggcggcctgggacaggctgggcgccgagcagttcgacgtggtggtgatc
ggcggcggcgtggtgggatcgggctccgcgctggacgccgccacccgcgggctcaaggtc
gcgctggtggaggcccgcgacttcgcctcgggcacctcgagccgttcctcgaagatgttc
cacggcggcctgcgctatctcgagcagctggagttcgggctggtgcgcgaggccctctac
gagcgcgagctgtcgctgaccacgctggcaccgcacctggtcaagccgatgccctttctg
ttcccgctgaccaatcggttgtgggaacggccctacatcgccgccggcatctttctctac
gaccggctgggtggggcgaaatccgttccggcgcaaaaacatttgacccgcgccggtgcg
ctgcggctgtgcccgggcctcaaacgcagcgcgctgatcggcgggatccgctactacgac
gccgtcgtcgacgacgcccggcacaccctgaccgtcgcgcgcaccgccgcgcactacggc
gtggtggtgcgcaactccacccaggtggtcgccctgctgcgggagggcgcccgggtgacc
ggggtgcgggtgcgcgactccgaagacggctcggtcaccgaggtccgcgggcatgtggtg
gtcaacgcgaccggcgtgtggaccgatgagatccaggcattgtccaagcagcgcgggcga
tttcaggtgcgggcatccaagggggtgcacgtggtggtgccgcgcgaccgcatcgtcagc
gacgtggcgatcatcctgcgcaccgagaagtcggtgatgttcgtcatcccgtggggcagc
cactggatcatcggaaccaccgacaccgactgggatctggacctggcccaccccgcggcc
accaaggccgacatcgactacatcctgtccaccgtcaacaccgtgctggccatacccctg
acccacgccgacatcgacggggtgtacgcggggctgcggccgctgctggccggggagagc
gaggaaacctccaagctgtcccgcgagcacgcggtggcggtgcccgcacccggcttggtg
gccatcgccggcggcaagtacaccacctaccgggtgatggctgccgacgcgattgacgct
gcggcgcaattcattccggcacgggtggcgccgtcgatcaccgagaaggtcagcctgctc
ggcgccgacggctacttcgcgctgatcaatcaggccgagcacgtcgcgcagctgcgcggg
ttgcatccctaccgggtgcgccacctgctggaccgctacggctcgctgatcggtgacgtg
ctggcgctggccgccgatcgccccgacctgctcaacccgatcacggaggcgccgggctat
ctgcgcgtggaggcgatgtacgccgtaaccgccgagggcgctttgcatttggaggacatc
ctggcccgccggatgcgcatctccatcgaatactcgcatcgcggcgtcgactgcgcccgc
gaggtggccgacgtggtcgctccggtgctggggtggacagccggcgacgtcgagcgcgag
gtcgtcaattacaccgcacgggtgcaggccgagatcctgtcgcaggcccagcccgacgac
gtgtcggccgacgagctgcgggccagcgcgcccgaggcgcgcgccgagatcctcgagccg
gtgccgctcaattga

DBGET integrated database retrieval system