KEGG   Mycobacterium lepraemurium: MLM_3457Help
Entry
MLM_3457          CDS       T05534                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mlp  Mycobacterium lepraemurium
Pathway
mlp00020  Citrate cycle (TCA cycle)
mlp00190  Oxidative phosphorylation
mlp00650  Butanoate metabolism
mlp01100  Metabolic pathways
mlp01110  Biosynthesis of secondary metabolites
mlp01120  Microbial metabolism in diverse environments
mlp01130  Biosynthesis of antibiotics
mlp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mlp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MLM_3457
   00650 Butanoate metabolism
    MLM_3457
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MLM_3457
Enzymes [BR:mlp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MLM_3457
    1.3.5.4  fumarate reductase (quinol)
     MLM_3457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO HI0933_like FAD_binding_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ATA29446
UniProt: A0A250BTQ8
LinkDB All DBs
Position
3500203..3501957
Genome map
AA seq 584 aa AA seqDB search
MIQQHRYDVVIVGAGGAGMRAAVEAGPRVRTAVLTKLYPTRSHTGAAQGGMCAALANVEE
DNWEWHTFDTVKGGDYLADQDAVEIMCKEAIDAVLDLEKMGMPFNRIPEGRIDQRRFGGH
TRNHGKAPVRRACYAADRTGHMILQTLYQNCVRHDVQFFNEFYPLDLVLTQPPSGPVASG
VVAYELATGDIHVFHAKAVVLATGGSGRMYKTTSNAHTLTGDGIGIVFRKGLPLEDMEFH
QFHPTGLAGLGILISEAVRGEGGRLLNGEGERFMERYAPTIVDLAPHDIVARSMVLEVLE
GRRAGPHKDYVYIDVRHLGEDVLESKLPDITEFARTYLGVDPVHELVPVYPTCHYVMGGI
PTTVTGQVLRDNTSTVPGLYAAGECACVSVHGANRLGTNSLLDINVFGRRAGIAAANYAR
GHDFVDMPPDPAAMVVRWVADILSGHGNERVSDIRGTLQQSMDNNAAVFRTEETLKRALT
DIHACKERYSRIRIHDKGKRFNSDLLEAIELGFLLELAEVTVVGALNRKESRGGHAREDY
PNRDDVNYMRHTMAYKQGTDLLSDIALDFKPVVQTRYEPKERKY
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgatccaacaacatcgctacgacgtggtgatcgtcggcgccggtggcgccgggatgcgc
gcggccgtggaagccggcccgcgggtgcgcaccgcggtgctgaccaagctctaccccacc
cgcagccacaccggggcggcccagggcggtatgtgcgcggcgctggccaacgtcgaggaa
gacaactgggaatggcacaccttcgacaccgtcaagggcggcgactacctcgccgaccag
gacgcggtggagatcatgtgcaaggaagccatcgacgcggtgctcgacctggagaagatg
gggatgccgttcaaccgcatccccgagggccgcatcgaccagcgccgcttcggcggccac
acccgcaaccacggcaaggccccggtgcgccgcgcctgttacgccgccgaccgcaccggc
cacatgatcctgcagacgctctaccagaactgtgtgcggcacgacgtgcagttcttcaac
gagttctacccgctggacctggttttgacgcagccgcccagcggcccggtggccagcggc
gtggtggcctacgagctagccaccggcgacatccacgtctttcacgccaaggccgtcgtg
ctcgccaccggcgggtcgggccggatgtacaagaccacctccaacgcgcacaccctgacc
ggcgacggcatcggcatcgtcttccgcaaggggcttcccttggaggacatggagtttcac
cagttccacccgaccggcctggccgggttggggattctgatctccgaggcggtgcgcggc
gagggcggccggctgctcaacggcgagggcgagcggttcatggagcgctacgcccccacc
atcgtcgacctggcgccgcacgacatcgtagcgcgctcaatggttttggaagtgctggag
ggccgccgcgccggcccgcacaaggactacgtctacatcgacgtacgccacctcggcgag
gacgtgctggagtccaagctgcccgacatcaccgagttcgcccgcacctacctgggcgtg
gacccggtgcacgagctggtgccggtgtacccgacgtgccactacgtgatgggcggcatc
cccaccacagtcaccggacaagtgttgcgggacaacacctccaccgtgccgggtctgtac
gcggccggcgagtgcgcgtgcgtgtcggtgcacggtgccaaccggctgggcaccaattcg
ctgctggacatcaacgtgttcggccgccgggccggcatcgccgcggccaactacgcccgg
ggccacgacttcgtggacatgccgccggacccggcggcgatggtagtgcgctgggtcgcc
gacatcctctccgggcacggcaacgagcgggtctccgacatccgcggcacgctgcagcag
tcgatggacaacaatgcggcggtgttccgcaccgaggagacgctcaagcgggcgctgacg
gacatccacgcatgcaaggagcggtactcgcgaatccgcatccacgacaaggggaaacga
ttcaacagcgacctgctggaagccatcgagctgggcttcctgctggagctggccgaggtc
accgtggtgggggcgctcaaccgcaaggagtcccgcggcggccacgcccgcgaggactat
cccaaccgggacgacgtcaactacatgcgccacaccatggcctacaaacagggcacggat
ctgctgagcgacatcgcgctggacttcaagcccgtggtgcagacgcgctacgaacccaag
gaacggaagtactga

DBGET integrated database retrieval system