KEGG   Mycobacterium lepraemurium: MLM_3458Help
Entry
MLM_3458          CDS       T05534                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mlp  Mycobacterium lepraemurium
Pathway
mlp00020  Citrate cycle (TCA cycle)
mlp00190  Oxidative phosphorylation
mlp00650  Butanoate metabolism
mlp01100  Metabolic pathways
mlp01110  Biosynthesis of secondary metabolites
mlp01120  Microbial metabolism in diverse environments
mlp01130  Biosynthesis of antibiotics
mlp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mlp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MLM_3458
   00650 Butanoate metabolism
    MLM_3458
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MLM_3458
Enzymes [BR:mlp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MLM_3458
    1.3.5.4  fumarate reductase (quinol)
     MLM_3458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4 Fer4_4 Fer4_6 Fer4_18 Fer4_15 Fer4_16 Fer4_3 Fer4_2
Motif
Other DBs
NCBI-ProteinID: ATA29447
UniProt: A0A250BTL7
LinkDB All DBs
Position
3501958..3502761
Genome map
AA seq 267 aa AA seqDB search
MSVEPDVETLEPPLSPVPDEAVMVTVKIARFNPDQPDAYAETGGWQSFRVPCLPSDRMLN
LLIYIKSYLDGTLTFRRSCAHGVCGSDAMRINGVNRLACKVLMCDLLPEPKKGKPSKPLT
ITVEPIRGLPVEKDLVVDMEPFFDAYRAVKPYLITTGNPPTRERIQSPADRARYDDTTKC
ILCAACTTSCPIFWHEGSYYGPAAIVNAHRFIFDSRDEGAAERLDILNEVDGVWRCRTTF
NCTDACPRGIEVTKAIQEVKHAIMFSR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgagccggacgtcgaaaccttggaaccgccgctgtcgccggttcccgacgaa
gcggtgatggtgaccgtcaagatcgcccggttcaaccccgaccagcccgatgcgtacgcg
gaaaccggtggctggcaaagctttcgggtgccgtgcctgcccagtgaccggatgctcaac
ctgctgatctacatcaagagctacctggacgggacgctgaccttccggcgttcctgcgcg
cacggggtgtgcggctcggacgccatgcgcatcaacggcgtcaaccggctggcgtgcaag
gtgctgatgtgcgatctgctgcccgagcccaagaagggcaagccgagcaagccgctgacc
atcacggtcgagccgatccgcgggctgccggtggaaaaggacctggtggtcgacatggag
ccgttcttcgacgcctaccgcgcggtcaagccgtacctgatcaccacaggcaatccgccc
acccgcgagcgcatccagagtccggccgaccgggcccgctacgacgacaccaccaagtgc
atcctgtgcgcggcgtgcaccaccagctgcccgatcttctggcacgagggcagctactac
ggcccggccgcgatcgtcaacgcgcaccggttcatcttcgacagccgcgacgagggcgcc
gccgagcggctggacatcctcaacgaggtcgacggcgtgtggcgctgccgcaccacgttc
aactgcaccgacgcctgcccgcgcggcatcgaggtgaccaaggccatccaagaggtcaag
cacgccatcatgttctcccgctga

DBGET integrated database retrieval system